SitesBLAST
Comparing GFF3591 FitnessBrowser__WCS417:GFF3591 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
45% identity, 98% coverage: 5:303/305 of query aligns to 2:298/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N185), T217 (= T221), G219 (= G223), A220 (= A224), G222 (= G226), F250 (= F255), N272 (≠ Q277), G275 (≠ A280), A276 (= A281), T279 (≠ V284)
- binding magnesium ion: D242 (= D247), T244 (= T249), A278 (≠ S283), S287 (= S292)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
43% identity, 98% coverage: 4:303/305 of query aligns to 3:302/306 of 4xckA
- active site: A249 (= A250), A250 (= A251), G251 (= G252), D252 (= D253)
- binding adenosine-5'-diphosphate: T220 (= T221), G222 (= G223), S223 (≠ A224), V242 (= V243), T247 (= T248), A250 (= A251), F254 (= F255), H276 (≠ Q277), A279 (= A280), V283 (= V284)
- binding alpha-D-ribofuranose: N11 (= N12), D13 (= D14), G39 (= G40), K40 (= K41), N43 (= N44), A95 (= A95), I107 (= I107), I109 (= I109), E140 (= E140), T248 (= T249), D252 (= D253)
6wjzA Crystal structure of human ribokinase in complex with ampcp
44% identity, 97% coverage: 3:299/305 of query aligns to 3:304/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N185), T222 (= T221), G224 (= G223), A225 (= A224), G227 (= G226), T243 (≠ A240), V246 (= V243), A254 (= A251), G255 (= G252), N282 (≠ Q277), A285 (= A280), A286 (= A281), V289 (= V284)
5c3yA Structure of human ribokinase crystallized with amppnp
44% identity, 97% coverage: 3:299/305 of query aligns to 2:303/306 of 5c3yA
- active site: G252 (≠ A250), A253 (= A251), G254 (= G252), D255 (= D253)
- binding amp phosphoramidate: T221 (= T221), G223 (= G223), V245 (= V243), T250 (= T248), G254 (= G252), N281 (≠ Q277), A284 (= A280), A285 (= A281)
2fv7A Crystal structure of human ribokinase
44% identity, 97% coverage: 3:299/305 of query aligns to 2:303/308 of 2fv7A
- active site: G252 (≠ A250), A253 (= A251), G254 (= G252), D255 (= D253)
- binding adenosine-5'-diphosphate: N185 (= N185), T221 (= T221), G223 (= G223), G226 (= G226), T242 (≠ A240), V245 (= V243), A253 (= A251), G254 (= G252), N281 (≠ Q277), A284 (= A280), A285 (= A281), V288 (= V284)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
44% identity, 97% coverage: 3:299/305 of query aligns to 3:304/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N185), T222 (= T221), G224 (= G223), A225 (= A224), G227 (= G226), T243 (≠ A240), V246 (= V243), A254 (= A251), G255 (= G252), N282 (≠ Q277), A285 (= A280), A286 (= A281), V289 (= V284)
- binding alpha-D-ribofuranose: D14 (= D14), G40 (= G40), K41 (= K41), N44 (= N44), A96 (= A95), E141 (= E140), D256 (= D253)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
44% identity, 97% coverage: 3:299/305 of query aligns to 3:304/317 of 5c41A
- active site: G253 (≠ A250), A254 (= A251), G255 (= G252), D256 (= D253)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N185), T222 (= T221), G224 (= G223), A225 (= A224), G227 (= G226), V246 (= V243), G255 (= G252), N282 (≠ Q277), A285 (= A280), A286 (= A281)
1gqtB Activation of ribokinase by monovalent cations (see paper)
42% identity, 98% coverage: 5:303/305 of query aligns to 6:304/307 of 1gqtB
- active site: A251 (= A250), A252 (= A251), G253 (= G252), D254 (= D253)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N185), T222 (= T221), G224 (= G223), S225 (≠ A224), A252 (= A251), G253 (= G252), H278 (≠ Q277), A281 (= A280)
- binding cesium ion: D248 (= D247), I250 (≠ T249), A284 (≠ S283), R287 (= R286), S293 (= S292)
- binding alpha-D-ribofuranose: N13 (= N12), D15 (= D14), G41 (= G40), N45 (= N44), E142 (= E140), D254 (= D253)
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
42% identity, 98% coverage: 5:303/305 of query aligns to 4:302/305 of 1rk2A
- active site: A249 (= A250), A250 (= A251), G251 (= G252), D252 (= D253)
- binding adenosine-5'-diphosphate: T220 (= T221), G222 (= G223), S223 (≠ A224), A250 (= A251), G251 (= G252), H276 (≠ Q277), A279 (= A280)
- binding tetrafluoroaluminate ion: G213 (= G214), R215 (≠ G216)
- binding magnesium ion: D246 (= D247), A282 (≠ S283), R285 (= R286), S291 (= S292)
- binding alpha-D-ribofuranose: N11 (= N12), D13 (= D14), G38 (= G39), G39 (= G40), K40 (= K41), N43 (= N44), E140 (= E140), D252 (= D253)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
42% identity, 98% coverage: 5:303/305 of query aligns to 7:305/309 of P0A9J6
6znxC Ribokinase from thermus species
42% identity, 98% coverage: 5:303/305 of query aligns to 2:263/265 of 6znxC
5byfA Crystal structure of human ribokinase in complex with amp
43% identity, 95% coverage: 9:299/305 of query aligns to 10:305/313 of 5byfA
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
43% identity, 95% coverage: 9:299/305 of query aligns to 22:317/322 of Q9H477
6a8cA Ribokinase from leishmania donovani with adp (see paper)
38% identity, 95% coverage: 5:294/305 of query aligns to 16:317/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G223), A246 (= A224), T271 (= T248), A274 (= A251), G275 (= G252), N300 (≠ Q277), A303 (= A280)
- binding glycerol: D25 (= D14), S42 (≠ G31), S44 (≠ T33), G50 (= G39), G51 (= G40), N55 (= N44)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
38% identity, 95% coverage: 5:294/305 of query aligns to 16:317/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G223), A246 (= A224), T271 (= T248), A274 (= A251), G275 (= G252), N300 (≠ Q277), A303 (= A280), V307 (= V284)
- binding glycerol: D25 (= D14), G50 (= G39), G51 (= G40), N55 (= N44), N157 (≠ L139), I159 (≠ V141), E190 (= E174)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
38% identity, 95% coverage: 5:294/305 of query aligns to 16:317/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N185), T243 (= T221), G245 (= G223), A246 (= A224), G248 (= G226), T271 (= T248), G273 (≠ A250), A274 (= A251), G275 (= G252), N300 (≠ Q277), A303 (= A280), V307 (= V284)
- binding glycerol: D25 (= D14), G50 (= G39), G51 (= G40), N55 (= N44)
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
37% identity, 96% coverage: 1:294/305 of query aligns to 1:300/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N185), K225 (≠ T221), G227 (= G223), I246 (≠ A240), A248 (≠ K242), A257 (= A251), G258 (= G252), F261 (= F255), A286 (= A280), S287 (≠ A281)
- binding alpha-D-ribofuranose: N12 (= N12), D14 (= D14), G40 (= G40), K41 (= K41), N44 (= N44), E144 (= E140), D259 (= D253)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 97% coverage: 5:299/305 of query aligns to 71:371/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
3go6B Crystal structure of m. Tuberculosis ribokinase (rv2436) in complex with ribose and amp-pnp
35% identity, 89% coverage: 4:274/305 of query aligns to 3:252/287 of 3go6B
- active site: G227 (≠ A250), A228 (= A251), G229 (= G252), D230 (= D253)
- binding adenosine-5'-diphosphate: G200 (= G223), V201 (≠ A224), G203 (= G226), V220 (= V243), T225 (= T248), A228 (= A251), G229 (= G252)
- binding magnesium ion: D224 (= D247), A226 (≠ T249)
Sites not aligning to the query:
3go6A Crystal structure of m. Tuberculosis ribokinase (rv2436) in complex with ribose and amp-pnp
35% identity, 89% coverage: 4:274/305 of query aligns to 3:252/287 of 3go6A
- active site: G227 (≠ A250), A228 (= A251), G229 (= G252), D230 (= D253)
- binding magnesium ion: D224 (= D247)
- binding alpha-D-ribofuranose: N11 (= N12), D13 (= D14), G39 (= G40), K40 (= K41), N43 (= N44), A94 (= A95), I96 (= I97), V106 (≠ I107), E134 (= E140), D230 (= D253)
Sites not aligning to the query:
Query Sequence
>GFF3591 FitnessBrowser__WCS417:GFF3591
MPAKVVVVGSLNMDLVTRASRLPRAGETLIGQTFSTVPGGKGANQAVASARLGADVSMIG
CVGSDAYGSQLREALLVEGIDCQAVSTVDGSSGVALIVVDDSSQNAIVIVAGSNGELTPA
SLQAFDAVLQAADVIVCQLEVPMNTVGYALKRGRELGKTVILNPAPASGPLPAEWYASID
YLIPNESEASALSGVTVDSIDAAKVAATQLIQAGAGKVIVTLGAQGALFTDGQRFEHLQA
PKVKAVDTTAAGDTFVGGFAAALANGKSEAEAIRFGQVAAALSVTRAGAQPSIPTLHDVQ
GFVPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory