Comparing GFF3594 FitnessBrowser__WCS417:GFF3594 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
40% identity, 95% coverage: 8:497/517 of query aligns to 3:491/501 of P04983
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
34% identity, 39% coverage: 23:225/517 of query aligns to 24:225/233 of P75957
7mdyC Lolcde nucleotide-bound
34% identity, 39% coverage: 23:225/517 of query aligns to 21:222/226 of 7mdyC
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
34% identity, 39% coverage: 23:225/517 of query aligns to 21:222/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
34% identity, 39% coverage: 23:225/517 of query aligns to 23:224/229 of 7v8iD
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
29% identity, 42% coverage: 9:223/517 of query aligns to 1:223/232 of 1f3oA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
33% identity, 39% coverage: 23:225/517 of query aligns to 22:222/615 of 5lilA
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
33% identity, 39% coverage: 23:225/517 of query aligns to 22:222/592 of 5lj7A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of Q97UY8
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 42% coverage: 9:224/517 of query aligns to 1:215/240 of 4ymuJ
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
28% identity, 42% coverage: 9:223/517 of query aligns to 1:223/230 of 1l2tA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
31% identity, 41% coverage: 9:221/517 of query aligns to 3:218/226 of 5xu1B
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
31% identity, 41% coverage: 15:226/517 of query aligns to 33:244/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
31% identity, 41% coverage: 15:226/517 of query aligns to 33:244/382 of 7aheC
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
33% identity, 41% coverage: 15:225/517 of query aligns to 7:217/222 of 8i6rB
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 43% coverage: 2:223/517 of query aligns to 12:226/378 of P69874
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
31% identity, 41% coverage: 15:226/517 of query aligns to 33:244/260 of 7ahdC
Sites not aligning to the query:
>GFF3594 FitnessBrowser__WCS417:GFF3594
MSSSAPNAVLSVSGIGKTYAQPVLSDITLTLNRGEVLALTGENGAGKSTLSKIIGGLVTP
TTGHMQFNGQDFRPGSRTQAEELGVRMVMQELNLLPTLTVAENLFLDNLPSHCGWISRKQ
LRKAAIEAMAQVGLDAIDPDTLVGSLGIGHQQMVEIARNLIGDCHVLILDEPTAMLTARE
VEMLFEQITRLQARGVAIIYISHRLEELARVAQRIAVLRDGKLVCVEPMANYNSEQLVTL
MVGRELGEHIDLGPRTIGGPALTVKGLTRSDKVRDVSFEVRAGEIYGISGLIGAGRTELL
RLIFGADLADSGTVALGSPAQVVSIRSPVDAVGHGIALITEDRKGEGLLLTQSISANIAL
GNMPEISGGGVVNSRDETALAKRQIDAMRIRSSSPAQLVSELSGGNQQKVVIGRWLERDC
SVMLFDEPTRGIDVGAKFDIYALLGELTRQGKALVVVSSDLRELMLICDRIGVLSAGRLI
ETFERDSWTQDELLAAAFAGYQKRDALLNDAVLRDTP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory