Comparing GFF3596 FitnessBrowser__psRCH2:GFF3596 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4y7uA Structural analysis of muru (see paper)
75% identity, 100% coverage: 1:222/223 of query aligns to 1:222/224 of 4y7uA
Q88QT2 N-acetylmuramate alpha-1-phosphate uridylyltransferase; MurNAc-1P uridylyltransferase; MurNAc-alpha-1P uridylyltransferase; EC 2.7.7.99 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
75% identity, 100% coverage: 1:222/223 of query aligns to 1:222/223 of Q88QT2
4y7vA Structural analysis of muru (see paper)
76% identity, 98% coverage: 1:219/223 of query aligns to 1:214/216 of 4y7vA
7d73E Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
34% identity, 93% coverage: 1:207/223 of query aligns to 1:220/360 of 7d73E
7d72K Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
34% identity, 93% coverage: 1:207/223 of query aligns to 1:220/360 of 7d72K
7d72E Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
34% identity, 93% coverage: 1:207/223 of query aligns to 1:220/360 of 7d72E
P74285 UTP--glucose-1-phosphate uridylyltransferase; Cyanobacterial UDP-glucose pyrophosphorylase; UDP-glucose pyrophosphorylase; UDP-Glc PPase; EC 2.7.7.9 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
32% identity, 87% coverage: 1:193/223 of query aligns to 1:201/388 of P74285
7x8kA Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
32% identity, 93% coverage: 1:207/223 of query aligns to 1:220/365 of 7x8kA
O22287 Mannose-1-phosphate guanylyltransferase 1; GDP-mannose pyrophosphorylase 1; Protein CYTOKINESIS DEFECTIVE 1; Protein EMBRYO DEFECTIVE 101; Protein HYPERSENSITIVE TO AMMONIUM ION 1; Protein SENSITIVE TO OZONE 1; Protein VITAMIN C DEFECTIVE 1; EC 2.7.7.13 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
32% identity, 93% coverage: 1:207/223 of query aligns to 1:221/361 of O22287
Sites not aligning to the query:
7x8kB Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
32% identity, 93% coverage: 1:207/223 of query aligns to 1:221/367 of 7x8kB
7whsA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gtp (see paper)
28% identity, 93% coverage: 1:207/223 of query aligns to 1:220/366 of 7whsA
7whtA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gdp-mannose (see paper)
30% identity, 93% coverage: 1:207/223 of query aligns to 1:213/360 of 7whtA
7d73B Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
29% identity, 93% coverage: 1:208/223 of query aligns to 2:236/406 of 7d73B
7d72A Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
28% identity, 93% coverage: 1:208/223 of query aligns to 2:237/407 of 7d72A
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
27% identity, 96% coverage: 2:214/223 of query aligns to 3:233/293 of 5ifyA
Sites not aligning to the query:
6t37A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
24% identity, 98% coverage: 2:219/223 of query aligns to 3:235/289 of 6t37A
Sites not aligning to the query:
4b5bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
26% identity, 98% coverage: 2:219/223 of query aligns to 4:239/293 of 4b5bA
Sites not aligning to the query:
4b4gA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
26% identity, 98% coverage: 2:219/223 of query aligns to 4:239/293 of 4b4gA
Sites not aligning to the query:
4b42A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
26% identity, 98% coverage: 2:219/223 of query aligns to 4:239/293 of 4b42A
Sites not aligning to the query:
4b3uA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
26% identity, 98% coverage: 2:219/223 of query aligns to 10:245/299 of 4b3uA
Sites not aligning to the query:
>GFF3596 FitnessBrowser__psRCH2:GFF3596
MKAMILAAGKGERLRPLTLHTPKPLVRAAGVPLIEYHVRALAAAGFDELVINHAWLGQQI
EDYLGDGQRFGVAIRYSAEGEPLETGGGIHRALGLLGDEPFLVVNGDIWTDYDFAQLRRP
LAGLAHLVLVDNPPHHPKGDFSLAESAVTEPEVSGDALTYSGISVLHPALFEGCQPGAFK
LAPLLRRAMADGQVSGECHAGLWVDVGTHERLAEVEQLLEARR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory