SitesBLAST
Comparing GFF36 FitnessBrowser__WCS417:GFF36 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
72% identity, 92% coverage: 16:396/413 of query aligns to 1:381/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H96), K82 (= K97), Q109 (≠ M124), S185 (≠ T200), G227 (= G242), G229 (= G244), S230 (= S245), N231 (= N246), E345 (= E360), S371 (= S386), G372 (= G387)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
60% identity, 95% coverage: 10:402/413 of query aligns to 8:403/405 of 6u6cB
- active site: K98 (= K97), E120 (= E119), S387 (= S386)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H96), K98 (= K97), T121 (= T120), G122 (= G121), A123 (= A122), Q125 (≠ M124), H126 (= H125), T201 (= T200), G243 (= G242), G245 (= G244), S246 (= S245), N247 (= N246), G314 (= G313), E361 (= E360), S387 (= S386)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (= Y25), F185 (≠ L184), W188 (= W187), Y197 (= Y196), F199 (≠ I198), G204 (= G203), P205 (= P204), H291 (= H290), G292 (= G291)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
60% identity, 95% coverage: 10:402/413 of query aligns to 8:403/406 of 5tciH
- active site: K98 (= K97), E120 (= E119), S387 (= S386)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (≠ A27), L31 (= L30), Y197 (= Y196), F199 (≠ I198), P205 (= P204), F208 (≠ Y207), H291 (= H290)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
61% identity, 93% coverage: 10:395/413 of query aligns to 3:391/399 of 5ocwB
- active site: K93 (= K97), E115 (= E119), S382 (= S386)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H96), K93 (= K97), T116 (= T120), G117 (= G121), A118 (= A122), Q120 (≠ M124), H121 (= H125), T196 (= T200), G238 (= G242), G240 (= G244), S241 (= S245), N242 (= N246), G309 (= G313), E356 (= E360), S382 (= S386)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
60% identity, 95% coverage: 10:402/413 of query aligns to 7:402/404 of 6usaB
- active site: K97 (= K97), E119 (= E119), S386 (= S386)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H96), K97 (= K97), T120 (= T120), G121 (= G121), A122 (= A122), G123 (= G123), Q124 (≠ M124), H125 (= H125), T200 (= T200), G242 (= G242), G244 (= G244), S245 (= S245), N246 (= N246), G313 (= G313), E360 (= E360), S386 (= S386)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ L184), W187 (= W187), Y196 (= Y196), F198 (≠ I198), G203 (= G203), P204 (= P204), F207 (≠ Y207), H290 (= H290), G291 (= G291)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
60% identity, 95% coverage: 10:402/413 of query aligns to 7:402/404 of 6dweB
- active site: K97 (= K97), E119 (= E119), S386 (= S386)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ L184), Y196 (= Y196), F198 (≠ I198), P204 (= P204), F207 (≠ Y207), H290 (= H290)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H96), K97 (= K97), T120 (= T120), G121 (= G121), A122 (= A122), G123 (= G123), Q124 (≠ M124), H125 (= H125), T200 (= T200), G242 (= G242), G244 (= G244), S245 (= S245), N246 (= N246), G313 (= G313), E360 (= E360), S386 (= S386)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
60% identity, 95% coverage: 10:402/413 of query aligns to 7:402/405 of 6uapB
- active site: K97 (= K97), E119 (= E119), S386 (= S386)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ M180), N181 (= N181), F184 (≠ L184), Y196 (= Y196), F198 (≠ I198), P204 (= P204), F207 (≠ Y207), H290 (= H290)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
61% identity, 92% coverage: 18:397/413 of query aligns to 3:382/388 of 5dw0A
- active site: K82 (= K97), E104 (= E119), S371 (= S386)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H96), K82 (= K97), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (≠ M124), H110 (= H125), S185 (≠ T200), G227 (= G242), G229 (= G244), S230 (= S245), N231 (= N246), G298 (= G313), D300 (= D315), E345 (= E360), S371 (= S386)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
61% identity, 92% coverage: 18:397/413 of query aligns to 3:382/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
61% identity, 92% coverage: 18:397/413 of query aligns to 3:382/386 of 1v8zA
- active site: K82 (= K97), E104 (= E119), S371 (= S386)
- binding pyridoxal-5'-phosphate: H81 (= H96), K82 (= K97), Q109 (≠ M124), S185 (≠ T200), G227 (= G242), G228 (= G243), G229 (= G244), S230 (= S245), N231 (= N246), E345 (= E360), S371 (= S386), G372 (= G387)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
60% identity, 92% coverage: 18:397/413 of query aligns to 3:382/385 of 6am8B
- active site: K82 (= K97), E104 (= E119), S371 (= S386)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H96), K82 (= K97), E104 (= E119), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (≠ M124), H110 (= H125), L161 (= L176), S185 (≠ T200), V187 (≠ A202), G227 (= G242), G228 (= G243), G229 (= G244), S230 (= S245), N231 (= N246), G298 (= G313), Y301 (= Y316), E345 (= E360), S371 (= S386), G372 (= G387)
- binding tryptophan: P12 (≠ A27), L169 (= L184), S274 (≠ L289), H275 (= H290)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
60% identity, 92% coverage: 18:397/413 of query aligns to 3:382/384 of 7rnpA
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
61% identity, 92% coverage: 18:397/413 of query aligns to 3:381/383 of 5dw3A
- active site: K82 (= K97), E104 (= E119), S370 (= S386)
- binding tryptophan: K82 (= K97), E104 (= E119), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (≠ M124), H110 (= H125), S185 (≠ T200), G228 (= G243), Y300 (= Y316)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
60% identity, 92% coverage: 18:397/413 of query aligns to 3:382/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H96), K82 (= K97), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (≠ M124), H110 (= H125), S185 (≠ T200), G227 (= G242), G229 (= G244), S230 (= S245), N231 (= N246), G298 (= G313), E345 (= E360), S371 (= S386)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
60% identity, 92% coverage: 18:397/413 of query aligns to 3:382/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H96), K82 (= K97), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (≠ M124), H110 (= H125), S185 (≠ T200), G227 (= G242), G229 (= G244), S230 (= S245), N231 (= N246), G298 (= G313), E345 (= E360), S371 (= S386)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
61% identity, 92% coverage: 18:397/413 of query aligns to 3:380/394 of 5ixjD
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
61% identity, 92% coverage: 18:397/413 of query aligns to 3:380/383 of 5t6mA
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
60% identity, 92% coverage: 18:397/413 of query aligns to 3:380/383 of 5vm5D
- active site: K82 (= K97), E104 (= E119), S369 (= S386)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H96), K82 (= K97), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (≠ M124), H110 (= H125), S185 (≠ T200), G227 (= G242), G229 (= G244), S230 (= S245), N231 (= N246), G296 (= G313), E343 (= E360), S369 (= S386)
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
61% identity, 93% coverage: 15:399/413 of query aligns to 1:380/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H96), K82 (= K97), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (≠ M124), H110 (= H125), S185 (≠ T200), G229 (= G244), S230 (= S245), N231 (= N246), G297 (= G313), E344 (= E360), S367 (= S386)
8eh0A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with quinoline n-oxide
61% identity, 93% coverage: 16:399/413 of query aligns to 1:379/385 of 8eh0A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H96), K81 (= K97), T104 (= T120), G105 (= G121), A106 (= A122), Q108 (≠ M124), H109 (= H125), S184 (≠ T200), G228 (= G244), S229 (= S245), N230 (= N246), G296 (= G313), E343 (= E360), S366 (= S386), G367 (= G387)
- binding 1-oxo-1lambda~5~-quinoline: L160 (= L176), I164 (≠ M180), Y180 (= Y196), P182 (≠ I198), G183 (= G199), S184 (≠ T200), V186 (≠ A202), Y299 (= Y316)
Query Sequence
>GFF36 FitnessBrowser__WCS417:GFF36
MTQSQTDLRHGPDANGLFGAFGGRYVAETLMPLILDLAREYEAAKEDPAFKEELAYFQRD
YVGRPSPLYFAERLTEFCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAET
GAGMHGVATATVAARFGLQCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAGTGTLKDAM
NEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETRDQLQAQEGRLPDSLVAC
IGGGSNAMGLFHPFLDDQSVEIIGVEAAGHGIETGKHAASLNGGVPGVLHGNRTFLLQDD
DGQIIDAHSISAGLDYPGIGPEHAWLHDIGRVQYTSVTDDEALDAFHKCCRLEGIIPALE
SAHALAEVFKRAPTLPKDHLMVVNLSGRGDKDMQTVMHHMELSLQEKTQQEKH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory