Comparing GFF3639 FitnessBrowser__Phaeo:GFF3639 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ma0A Closed liganded crystal structure of xylose binding protein from escherichia coli (see paper)
42% identity, 90% coverage: 22:328/341 of query aligns to 1:305/313 of 3ma0A
4ywhA Crystal structure of an abc transporter solute binding protein (ipr025997) from actinobacillus succinogenes 130z (asuc_0499, target efi-511068) with bound d-xylose
40% identity, 91% coverage: 22:331/341 of query aligns to 2:310/310 of 4ywhA
3uugA Crystal structure of the periplasmic sugar binding protein chve (see paper)
30% identity, 89% coverage: 25:329/341 of query aligns to 4:328/329 of 3uugA
3urmA Crystal structure of the periplasmic sugar binding protein chve (see paper)
30% identity, 89% coverage: 25:329/341 of query aligns to 4:328/329 of 3urmA
4ys6A Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentans (cphy_1585, target efi- 511156) with bound beta-d-glucose
31% identity, 89% coverage: 26:329/341 of query aligns to 3:323/324 of 4ys6A
4wwhA Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi- 510967) with bound d-galactose
30% identity, 89% coverage: 25:326/341 of query aligns to 4:325/329 of 4wwhA
4rxuA Crystal structure of carbohydrate transporter solute binding protein caur_1924 from chloroflexus aurantiacus, target efi-511158, in complex with d-glucose
29% identity, 89% coverage: 22:325/341 of query aligns to 2:332/340 of 4rxuA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
30% identity, 77% coverage: 25:285/341 of query aligns to 2:255/274 of 2ioyA
6ruxA P46, an immunodominant surface protein from mycoplasma hyopneumoniae (see paper)
28% identity, 56% coverage: 83:273/341 of query aligns to 70:311/373 of 6ruxA
6s3tA P46, an immunodominant surface protein from mycoplasma hyopneumoniae (see paper)
28% identity, 56% coverage: 83:273/341 of query aligns to 72:313/374 of 6s3tA
Sites not aligning to the query:
P23905 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
27% identity, 85% coverage: 2:292/341 of query aligns to 4:307/332 of P23905
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
28% identity, 80% coverage: 26:299/341 of query aligns to 9:281/287 of 4yo7A
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
32% identity, 57% coverage: 60:253/341 of query aligns to 41:235/291 of 4rxmA
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
32% identity, 57% coverage: 60:253/341 of query aligns to 39:233/288 of 4rxmB
Sites not aligning to the query:
1gcaA The 1.7 angstroms refined x-ray structure of the periplasmic glucose(slash)galactose receptor from salmonella typhimurium (see paper)
28% identity, 79% coverage: 23:292/341 of query aligns to 2:284/309 of 1gcaA
3ga5A X-ray structure of glucose/galactose receptor from salmonella typhimurium in complex with (2r)-glyceryl-beta-d-galactopyranoside (see paper)
29% identity, 73% coverage: 43:292/341 of query aligns to 16:282/305 of 3ga5A
Sites not aligning to the query:
P0AEE5 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Escherichia coli (strain K12) (see 4 papers)
28% identity, 79% coverage: 13:280/341 of query aligns to 10:298/332 of P0AEE5
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
32% identity, 65% coverage: 59:278/341 of query aligns to 40:259/287 of 5dteB
Sites not aligning to the query:
2qw1A Glucose/galactose binding protein bound to 3-o-methyl d-glucose (see paper)
28% identity, 76% coverage: 23:280/341 of query aligns to 1:274/305 of 2qw1A
2gbpA Sugar and signal-transducer binding sites of the escherichia coli galactose chemoreceptor protein (see paper)
28% identity, 76% coverage: 23:280/341 of query aligns to 2:275/309 of 2gbpA
>GFF3639 FitnessBrowser__Phaeo:GFF3639
MKFLSGVSALAFAATASMAFAEDVTVGVSWSNFQEERWKTDEAAIKAALEAKGATYVSAD
AQSSSAKQLSDIESLIAQGVDALIVLAQDAQAIGPAVQAAADEGIPVVAYDRLIEDGRAF
YLTFDNVEVGRMQARAVLEAQPSGNYVMIKGSPTDPNADFLRGGQQEIIQAAIDSGDIKI
VGEAYTDGWLPANAQRNMEQILTANDNKVDAVVASNDGTAGGVVAALTAQGMEGIAVSGQ
DGDHAALNRVAKGTQTVSVWKDARDLGKAAANIAVEMAEGAVMGDVAGGAAWTSPAGTEL
TARFLEPIPVTADNLSVVVDAGWITKEALCQGVTNGPAPCN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory