Comparing GFF3641 FitnessBrowser__Marino:GFF3641 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 86% coverage: 20:244/262 of query aligns to 30:251/265 of P07821
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 81% coverage: 20:232/262 of query aligns to 36:239/378 of P69874
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 91% coverage: 1:238/262 of query aligns to 2:233/240 of 6mjpA
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 89% coverage: 1:232/262 of query aligns to 3:229/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 89% coverage: 1:232/262 of query aligns to 3:229/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 89% coverage: 1:232/262 of query aligns to 3:229/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 89% coverage: 1:232/262 of query aligns to 3:229/242 of 2oljA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
34% identity, 77% coverage: 15:217/262 of query aligns to 21:218/226 of 5xu1B
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
30% identity, 83% coverage: 24:240/262 of query aligns to 22:231/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
29% identity, 83% coverage: 24:240/262 of query aligns to 22:231/248 of 4fi3C
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 89% coverage: 1:233/262 of query aligns to 2:228/241 of 4u00A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
29% identity, 92% coverage: 21:261/262 of query aligns to 46:278/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
29% identity, 92% coverage: 21:261/262 of query aligns to 46:278/382 of 7aheC
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
31% identity, 90% coverage: 2:238/262 of query aligns to 3:233/235 of 6mhzA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
31% identity, 90% coverage: 2:238/262 of query aligns to 3:233/233 of 6b8bA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 87% coverage: 1:229/262 of query aligns to 1:224/240 of 4ymuJ
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
31% identity, 90% coverage: 2:238/262 of query aligns to 3:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
31% identity, 90% coverage: 2:238/262 of query aligns to 3:233/238 of 6s8gA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
31% identity, 90% coverage: 2:238/262 of query aligns to 3:233/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
31% identity, 90% coverage: 2:238/262 of query aligns to 3:233/234 of 4p31A
>GFF3641 FitnessBrowser__Marino:GFF3641
MLEARELAIGYGRTQIGSGLNLSVNEGEILCLLGPNGCGKTTLFRTLLGLLPAMSGTVTL
GNRPVANQTPATIAQQIAYVPQAHAPPFPFEALEVVLMGRTARLGVFGQPGHHDREIAHN
AMDRLGIANLAHRDYSRLSGGQRQLVLIARALAQEAPLIVMDEPTASLDFGNQAQVLMQI
ASLARDVAARGCGVVLSTHDPDQAFALDARVLLMKDGHELAQGTARDVLTGPNLSDVYGL
PVAVETTSSGRKVCMPALTSHH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory