SitesBLAST
Comparing GFF3661 FitnessBrowser__WCS417:GFF3661 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 97% coverage: 2:248/254 of query aligns to 10:261/265 of P07821
- K50 (= K42) mutation to Q: Lack of activity.
- D172 (= D164) mutation to E: Lack of activity.
- E173 (= E165) mutation to A: Lack of activity.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
36% identity, 82% coverage: 15:222/254 of query aligns to 14:220/374 of 2awnB
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
36% identity, 82% coverage: 15:222/254 of query aligns to 12:218/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (≠ N38), G36 (= G39), C37 (≠ S40), G38 (= G41), K39 (= K42), S40 (= S43), T41 (= T44), R126 (= R135), A130 (≠ S139), S132 (= S141), G134 (= G143), Q135 (≠ E144)
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
36% identity, 82% coverage: 15:222/254 of query aligns to 14:220/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (≠ N38), G38 (= G39), C39 (≠ S40), G40 (= G41), K41 (= K42), S42 (= S43), T43 (= T44), Q81 (≠ D96), R128 (= R135), A132 (≠ S139), S134 (= S141), G136 (= G143), Q137 (≠ E144), E158 (= E165), H191 (= H194)
- binding magnesium ion: S42 (= S43), Q81 (≠ D96)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
36% identity, 82% coverage: 15:222/254 of query aligns to 14:220/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G39), C39 (≠ S40), G40 (= G41), K41 (= K42), S42 (= S43), T43 (= T44), R128 (= R135), S134 (= S141), Q137 (≠ E144)
- binding beryllium trifluoride ion: S37 (≠ N38), G38 (= G39), K41 (= K42), Q81 (≠ D96), S134 (= S141), G136 (= G143), H191 (= H194)
- binding magnesium ion: S42 (= S43), Q81 (≠ D96)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
36% identity, 82% coverage: 15:222/254 of query aligns to 14:220/371 of 3puwA
- binding adenosine-5'-diphosphate: V17 (≠ L18), G38 (= G39), C39 (≠ S40), G40 (= G41), K41 (= K42), S42 (= S43), T43 (= T44), R128 (= R135), A132 (≠ S139), S134 (= S141), Q137 (≠ E144)
- binding tetrafluoroaluminate ion: S37 (≠ N38), G38 (= G39), K41 (= K42), Q81 (≠ D96), S134 (= S141), G135 (= G142), G136 (= G143), E158 (= E165), H191 (= H194)
- binding magnesium ion: S42 (= S43), Q81 (≠ D96)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
36% identity, 82% coverage: 15:222/254 of query aligns to 14:220/371 of 3puvA
- binding adenosine-5'-diphosphate: V17 (≠ L18), G38 (= G39), C39 (≠ S40), G40 (= G41), K41 (= K42), S42 (= S43), T43 (= T44), R128 (= R135), A132 (≠ S139), S134 (= S141), Q137 (≠ E144)
- binding magnesium ion: S42 (= S43), Q81 (≠ D96)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
36% identity, 82% coverage: 15:222/254 of query aligns to 15:221/371 of P68187
- A85 (= A99) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ D116) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ L124) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V127) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A129) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (vs. gap) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G143) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D164) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 80% coverage: 20:222/254 of query aligns to 20:221/369 of P19566
- L86 (= L100) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P166) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D171) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
5x40A Structure of a cbio dimer bound with amppcp (see paper)
40% identity, 82% coverage: 17:224/254 of query aligns to 19:229/280 of 5x40A
- binding phosphomethylphosphonic acid adenylate ester: A20 (≠ L18), N40 (= N38), G41 (= G39), G43 (= G41), K44 (= K42), S45 (= S43), T46 (= T44), Q88 (= Q84), H139 (≠ R138), M140 (≠ S139), L141 (= L140), S142 (= S141), G144 (= G143), Q145 (≠ E144), Q166 (≠ E165), H198 (= H194)
- binding magnesium ion: S45 (= S43), Q88 (= Q84)
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
38% identity, 84% coverage: 3:215/254 of query aligns to 5:225/233 of P75957
- G42 (= G36) mutation to D: Loss of lipoprotein release when overexpressed.
7mdyC Lolcde nucleotide-bound
38% identity, 84% coverage: 3:215/254 of query aligns to 2:222/226 of 7mdyC
- binding adp orthovanadate: Y12 (≠ V13), G42 (= G39), S43 (= S40), G44 (= G41), K45 (= K42), S46 (= S43), T47 (= T44), Q91 (= Q84), H138 (≠ R138), E142 (≠ S139), S144 (= S141), G145 (= G142), G146 (= G143), E168 (= E165), N172 (≠ H169), H201 (= H194)
- binding magnesium ion: S46 (= S43), Q91 (= Q84)
7arlD Lolcde in complex with lipoprotein and adp (see paper)
38% identity, 84% coverage: 3:215/254 of query aligns to 2:222/222 of 7arlD
1g291 Malk (see paper)
33% identity, 82% coverage: 15:222/254 of query aligns to 15:227/372 of 1g291
- binding magnesium ion: D69 (≠ K69), E71 (≠ S71), K72 (≠ R72), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (≠ N38), G39 (= G39), C40 (≠ S40), G41 (= G41), K42 (= K42), T43 (≠ S43), T44 (= T44)
Sites not aligning to the query:
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
37% identity, 84% coverage: 3:215/254 of query aligns to 4:224/229 of 7v8iD
- binding phosphoaminophosphonic acid-adenylate ester: V23 (vs. gap), S43 (≠ N38), G44 (= G39), G46 (= G41), K47 (= K42), S48 (= S43), T49 (= T44), Q93 (= Q84), R137 (= R135), H140 (≠ R138), E144 (≠ S139), S146 (= S141), G148 (= G143), E149 (= E144), H203 (= H194)
- binding magnesium ion: S48 (= S43), Q93 (= Q84)
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
33% identity, 87% coverage: 3:224/254 of query aligns to 1:226/276 of Q5M243
- Q90 (≠ D89) mutation to A: No effect on ATPase, 10-fold decrease in riboflavin uptake; when associated with A-97 in EcfA2.
- E163 (= E165) mutation to Q: 10-fold decrease in ATPase and riboflavin uptake; when associated with Q-171 in EcfA2.
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
39% identity, 66% coverage: 14:180/254 of query aligns to 18:184/226 of 5xu1B
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
33% identity, 80% coverage: 19:222/254 of query aligns to 22:230/375 of 2d62A
3d31A Modbc from methanosarcina acetivorans (see paper)
36% identity, 81% coverage: 19:223/254 of query aligns to 16:216/348 of 3d31A
Sites not aligning to the query:
7qkrA Cryo-em structure of abc transporter ste6-2p from pichia pastoris with verapamil at 3.2 a resolution (see paper)
34% identity, 81% coverage: 18:223/254 of query aligns to 379:595/1199 of 7qkrA
Sites not aligning to the query:
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: 210, 268, 312
- binding phosphoaminophosphonic acid-adenylate ester: 371
- binding Dexverapamil: 272, 645, 692, 794, 905, 907, 908, 911, 912
Query Sequence
>GFF3661 FitnessBrowser__WCS417:GFF3661
MTVLSCRGLGFKVREAQLLRDIHLDVQPGETLGIVGPNGSGKSTLLKLLAGLRTPASGEV
LLGGQRLGKLSRRAIAQQLAVVEQQADTDDAIRVFDAVALGRTPWLSALSPWSGEDDAIV
NQALRDVDATHLSHRAWRSLSGGERQRVHIARALAQRPQILLLDEPTNHLDIQHQLGILQ
GVQGLPVTTLIALHDLNQALTCDRLAVLDHGRLVALGKPLEVLTPQRLQETFGVQAHYLT
DPFDGAQILRLRPN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory