SitesBLAST
Comparing GFF3677 FitnessBrowser__Marino:GFF3677 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ykgA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with NAD+ from escherichia coli (see paper)
64% identity, 98% coverage: 1:518/528 of query aligns to 1:518/521 of 4ykgA
- active site: C345 (= C345), C348 (= C348), D349 (= D349)
- binding flavin-adenine dinucleotide: G221 (= G221), P222 (= P222), A223 (= A223), G242 (≠ A242), E243 (= E243), G247 (= G247), Q248 (= Q248), T252 (= T252), N257 (= N257), S289 (≠ R289), A290 (= A290), T322 (= T322), G323 (= G323), C348 (= C348), G487 (= G487), D488 (= D488), Q496 (= Q496), I497 (= I497)
- binding nicotinamide-adenine-dinucleotide: I361 (= I361), G364 (= G364), S366 (= S366), E385 (= E385), F386 (= F386), I449 (= I449), M467 (≠ H467), P493 (= P493)
4ykfA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with nadh from escherichia coli (see paper)
64% identity, 98% coverage: 1:518/528 of query aligns to 1:518/521 of 4ykfA
- active site: C345 (= C345), C348 (= C348), D349 (= D349)
- binding flavin-adenine dinucleotide: G221 (= G221), P222 (= P222), A223 (= A223), G242 (≠ A242), E243 (= E243), G247 (= G247), Q248 (= Q248), N257 (= N257), A290 (= A290), T322 (= T322), G323 (= G323), C348 (= C348), N454 (= N454), D488 (= D488), Q496 (= Q496), I497 (= I497)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I361 (= I361), G364 (= G364), N365 (= N365), S366 (= S366), E385 (= E385), F386 (= F386), K391 (≠ R391), I449 (= I449), M467 (≠ H467)
P35340 Alkyl hydroperoxide reductase subunit F; Alkyl hydroperoxide reductase F52A protein; EC 1.8.1.- from Escherichia coli (strain K12) (see paper)
64% identity, 98% coverage: 1:518/528 of query aligns to 1:518/521 of P35340
- K53 (≠ R53) modified: N6-acetyllysine
- K354 (= K354) modified: N6-acetyllysine
1hyuA Crystal structure of intact ahpf (see paper)
63% identity, 98% coverage: 1:520/528 of query aligns to 1:520/521 of 1hyuA
- binding flavin-adenine dinucleotide: G221 (= G221), P222 (= P222), A223 (= A223), E243 (= E243), G247 (= G247), Q248 (= Q248), N257 (= N257), S289 (≠ R289), A290 (= A290), T322 (= T322), G323 (= G323), W326 (= W326), C345 (= C345), D488 (= D488), K495 (= K495), Q496 (= Q496), I497 (= I497)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
37% identity, 56% coverage: 210:507/528 of query aligns to 3:296/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G219), G14 (= G221), P15 (= P222), A16 (= A223), F34 (≠ A241), E35 (≠ A242), K36 (≠ E243), G41 (= G247), A42 (≠ Q248), V83 (≠ L293), T112 (= T322), G113 (= G323), G276 (= G487), D277 (= D488)
- binding nicotinamide-adenine-dinucleotide: G153 (= G363), G154 (= G364), S156 (= S366), Q175 (≠ E385), N176 (≠ F386), T181 (≠ R391), V238 (≠ I449)
3ctyB Crystal structure of t. Acidophilum thioredoxin reductase (see paper)
38% identity, 57% coverage: 213:512/528 of query aligns to 5:300/305 of 3ctyB
- active site: A38 (vs. gap), T42 (≠ V249), L47 (≠ G254), N50 (= N257), C133 (= C345), C136 (= C348), D137 (= D349)
- binding flavin-adenine dinucleotide: V10 (≠ I218), G11 (= G219), A15 (= A223), D34 (≠ A242), K35 (≠ E243), G40 (= G247), L41 (≠ Q248), T42 (≠ V249), A45 (≠ T252), P46 (≠ M253), N50 (= N257), V82 (≠ I284), T110 (= T322), G111 (= G323), S154 (= S366), Q241 (≠ N454), G275 (= G487), D276 (= D488), A283 (≠ K495), Q284 (= Q496), I285 (= I497)
7aawA Thioredoxin reductase from bacillus cereus (see paper)
35% identity, 59% coverage: 207:515/528 of query aligns to 1:305/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G219), G15 (= G221), P16 (= P222), A17 (= A223), E36 (= E243), R37 (= R244), G42 (= G247), Q43 (= Q248), T47 (= T252), N52 (= N257), G82 (≠ M287), V84 (≠ R289), A111 (≠ S321), S112 (≠ T322), G113 (= G323), C138 (= C348), G277 (= G487), D278 (= D488), Q286 (= Q496), I287 (= I497)
- binding alpha-D-glucopyranose: R27 (= R233), D49 (≠ G254), K74 (≠ E279), F75 (≠ Y280), P122 (= P332), G123 (= G333), E126 (= E336), G129 (≠ N339), G131 (= G341), V132 (= V342), F143 (= F353), E206 (= E416), N208 (≠ T418)
7aawB Thioredoxin reductase from bacillus cereus (see paper)
36% identity, 57% coverage: 213:515/528 of query aligns to 4:302/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G219), G12 (= G221), P13 (= P222), A14 (= A223), E33 (= E243), R34 (= R244), G39 (= G247), Q40 (= Q248), T44 (= T252), N49 (= N257), G79 (≠ M287), D80 (≠ Q288), V81 (≠ R289), S109 (≠ T322), G110 (= G323), Y113 (≠ W326), C135 (= C348), G274 (= G487), D275 (= D488), Q283 (= Q496), I284 (= I497)
- binding alpha-D-glucopyranose: D46 (≠ G254), E48 (= E256), G126 (≠ N339), G128 (= G341), D136 (= D349), A138 (≠ P351), F139 (≠ L352), F139 (≠ L352), F140 (= F353)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G363), G151 (= G364), D152 (≠ N365), S153 (= S366), E156 (= E369), H172 (≠ E385), R173 (≠ F386), R174 (≠ G387), R178 (= R391), I236 (= I449)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
34% identity, 57% coverage: 213:515/528 of query aligns to 5:303/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G221), P14 (= P222), A15 (= A223), E34 (≠ A242), Q35 (≠ E243), G40 (= G247), Q41 (= Q248), T45 (= T252), N50 (= N257), V82 (≠ M287), T110 (= T322), G111 (= G323), Y114 (≠ W326), C136 (= C348), V242 (≠ N454), G275 (= G487), D276 (= D488), Q284 (= Q496), I285 (= I497)
4gcmB Crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. Aureus mu50 at 1.80 a resolution
35% identity, 57% coverage: 213:515/528 of query aligns to 5:303/309 of 4gcmB
- active site: C133 (= C345), C136 (= C348), D137 (= D349)
- binding flavin-adenine dinucleotide: G11 (= G219), G13 (= G221), P14 (= P222), A15 (= A223), E34 (= E243), R35 (= R244), G40 (= G247), Q41 (= Q248), T45 (= T252), N50 (= N257), D81 (≠ K292), I82 (≠ L293), T110 (= T322), G111 (= G323), C136 (= C348), G275 (= G487), D276 (= D488), Q284 (= Q496), I285 (= I497)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I117 (≠ M329), G151 (= G363), G152 (= G364), D153 (≠ N365), S154 (= S366), E157 (= E369), R174 (≠ F386), R175 (≠ G387), R179 (= R391), Q181 (≠ D393), I237 (= I449)
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
36% identity, 56% coverage: 213:509/528 of query aligns to 8:304/313 of 2q7vA
- active site: P41 (vs. gap), I45 (≠ V249), E50 (≠ G254), C141 (= C345), C144 (= C348), D145 (= D349)
- binding flavin-adenine dinucleotide: G16 (= G221), P17 (= P222), A18 (= A223), E37 (≠ A242), K38 (≠ E243), G43 (= G247), Q44 (= Q248), I45 (≠ V249), N53 (= N257), E85 (≠ M287), V86 (≠ Q288), T118 (= T322), G119 (= G323), C144 (= C348), G282 (= G487), D283 (= D488), Q291 (= Q496), L292 (≠ I497), S295 (= S500)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
37% identity, 57% coverage: 214:515/528 of query aligns to 11:316/319 of 5u63B
- active site: C139 (= C345), C142 (= C348), D143 (= D349)
- binding flavin-adenine dinucleotide: G16 (= G219), S17 (≠ G220), G18 (= G221), P19 (= P222), A20 (= A223), T39 (= T238), G40 (= G239), Q42 (≠ A241), G45 (= G247), Q46 (= Q248), L47 (≠ V249), T50 (= T252), N55 (= N257), H87 (≠ R289), I88 (≠ A290), A115 (≠ S321), T116 (= T322), G117 (= G323), H248 (≠ L451), G288 (= G487), D289 (= D488), R296 (≠ K495), Q297 (= Q496), A298 (≠ I497), S301 (= S500)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (= R327), G157 (= G363), H179 (≠ E385), R180 (≠ F386), R181 (≠ G387), I246 (= I449), G247 (= G450), H248 (≠ L451), R296 (≠ K495)
3f8pD Structure of sulfolobus solfataricus trxr-b3 (see paper)
32% identity, 58% coverage: 211:515/528 of query aligns to 5:307/310 of 3f8pD
- active site: C135 (= C345), C138 (= C348), D139 (= D349)
- binding nicotinamide-adenine-dinucleotide: V12 (≠ I218), G13 (= G219), L14 (≠ G220), G15 (= G221), P16 (= P222), A17 (= A223), G36 (≠ A242), T38 (≠ R244), G41 (= G247), Q42 (= Q248), I82 (≠ R289), V83 (≠ A290), G111 (≠ S321), I112 (≠ T322), G113 (= G323), G277 (= G487), D278 (= D488)
3f8rA Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two NADP molecules (see paper)
31% identity, 58% coverage: 211:515/528 of query aligns to 5:305/308 of 3f8rA
- active site: C133 (= C345), C136 (= C348), D137 (= D349)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V12 (≠ I218), G13 (= G219), L14 (≠ G220), G15 (= G221), P16 (= P222), A17 (= A223), E37 (= E243), T38 (≠ R244), G41 (= G247), Q42 (= Q248), I82 (vs. gap), V83 (vs. gap), G109 (≠ S321), I110 (≠ T322), G111 (= G323), R115 (= R327), L117 (≠ M329), D153 (≠ N365), S154 (= S366), E157 (= E369), R174 (≠ F386), R175 (≠ G387), Y184 (≠ L396), I236 (= I449), G275 (= G487), D276 (= D488), L282 (≠ V492), G283 (≠ P493), R285 (≠ K495)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
35% identity, 57% coverage: 214:515/528 of query aligns to 5:303/306 of 5uthA
- active site: C133 (= C345), C136 (= C348), D137 (= D349)
- binding flavin-adenine dinucleotide: I9 (= I218), G10 (= G219), S11 (≠ G220), G12 (= G221), P13 (= P222), A14 (= A223), F32 (vs. gap), E33 (≠ A241), G34 (≠ A242), Q36 (≠ R244), G39 (= G247), A40 (≠ Q248), L41 (≠ V249), N49 (= N257), D81 (≠ K292), V82 (≠ L293), M110 (≠ T322), G111 (= G323), C136 (= C348), G275 (= G487), D276 (= D488), R283 (≠ K495), Q284 (= Q496), A285 (≠ I497), A288 (≠ S500)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
35% identity, 57% coverage: 214:515/528 of query aligns to 4:302/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (= I218), G9 (= G219), S10 (≠ G220), G11 (= G221), P12 (= P222), A13 (= A223), E32 (≠ A241), G33 (≠ A242), Q35 (≠ R244), G38 (= G247), A39 (≠ Q248), L40 (≠ V249), T43 (= T252), N48 (= N257), D80 (≠ K292), V81 (≠ L293), M109 (≠ T322), G110 (= G323), T131 (≠ Y344), C135 (= C348), G274 (= G487), D275 (= D488), R282 (≠ K495), Q283 (= Q496), A284 (≠ I497), A287 (≠ S500)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R327), H115 (≠ Q328), L116 (≠ M329), R173 (≠ F386), E200 (≠ Q413), I201 (≠ T414), I235 (= I449)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
35% identity, 57% coverage: 214:515/528 of query aligns to 4:302/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (= I218), G9 (= G219), S10 (≠ G220), G11 (= G221), P12 (= P222), A13 (= A223), E32 (≠ A241), G33 (≠ A242), Q35 (≠ R244), G38 (= G247), A39 (≠ Q248), L40 (≠ V249), T43 (= T252), N48 (= N257), D80 (≠ K292), V81 (≠ L293), M109 (≠ T322), G110 (= G323), T131 (≠ Y344), C135 (= C348), G274 (= G487), D275 (= D488), R282 (≠ K495), Q283 (= Q496), A284 (≠ I497), A287 (≠ S500)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (≠ M329), R173 (≠ F386), E200 (≠ Q413), I201 (≠ T414)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
35% identity, 57% coverage: 214:515/528 of query aligns to 4:302/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G219), S10 (≠ G220), G11 (= G221), P12 (= P222), A13 (= A223), E32 (≠ A241), G33 (≠ A242), Q35 (≠ R244), G38 (= G247), A39 (≠ Q248), L40 (≠ V249), T43 (= T252), N48 (= N257), D80 (≠ K292), V81 (≠ L293), M109 (≠ T322), G110 (= G323), T131 (≠ Y344), C135 (= C348), G274 (= G487), D275 (= D488), R282 (≠ K495), Q283 (= Q496), A284 (≠ I497), A287 (≠ S500)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R327), H115 (≠ Q328), L116 (≠ M329), V148 (≠ I361), R173 (≠ F386), E200 (≠ Q413), I201 (≠ T414)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
35% identity, 57% coverage: 214:515/528 of query aligns to 4:302/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (= I218), G9 (= G219), S10 (≠ G220), G11 (= G221), P12 (= P222), A13 (= A223), E32 (≠ A241), G33 (≠ A242), Q35 (≠ R244), G38 (= G247), A39 (≠ Q248), L40 (≠ V249), T43 (= T252), N48 (= N257), D80 (≠ K292), V81 (≠ L293), M109 (≠ T322), G110 (= G323), T131 (≠ Y344), C135 (= C348), G274 (= G487), D275 (= D488), R282 (≠ K495), Q283 (= Q496), A284 (≠ I497), A287 (≠ S500)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G363), G151 (= G364), D152 (≠ N365), S153 (= S366), E156 (= E369), H172 (≠ E385), R173 (≠ F386), R174 (≠ G387), R178 (= R391), I235 (= I449)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
32% identity, 58% coverage: 213:516/528 of query aligns to 2:301/303 of 5mh4A
- active site: V34 (vs. gap), P35 (vs. gap), M39 (≠ V249), E44 (≠ G254), C130 (= C345), C133 (= C348), D134 (= D349)
- binding flavin-adenine dinucleotide: G10 (= G221), P11 (= P222), A12 (= A223), E31 (= E243), R32 (= R244), G37 (= G247), Q38 (= Q248), T42 (= T252), N47 (= N257), G77 (≠ K292), V79 (≠ I294), T107 (= T322), G108 (= G323), E155 (≠ A370), V239 (≠ N454), F242 (≠ W457), G272 (= G487), D273 (= D488), Q281 (= Q496), I282 (= I497)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (= I361), G147 (= G362), G148 (= G363), G149 (= G364), D150 (≠ N365), S151 (= S366), E154 (= E369), H170 (≠ E385), R171 (≠ F386), R172 (≠ G387), R176 (= R391), V234 (≠ I449), G235 (= G450), R280 (≠ K495), Q281 (= Q496)
Query Sequence
>GFF3677 FitnessBrowser__Marino:GFF3677
MLDANIKEQLKAYMDKLQQPIELVAAYDDSKKSQELRELLEELEPMSSKISLRTEESNDV
RRPSFAINRVGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKASQDVIEQIQSLEGRFE
FETYFSLSCQNCPDVVQALNLMSVLNPNITNTSIDGALFQDEVEQREVMAVPSVYMNGEP
WGQGRMTLEEIVAKLDTSSSEKDAEKINQKDAFEVLIIGGGPAGASAAIYAARKGISTGI
AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQNVKEYDVDIMNMQRAEKLIPASRPG
MLHQVRLENGATLKARSLVLSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVGHVTLIEFGAEMRADEVLQKKLRSLKNVEIITSGQTTEITGE
NGKVNGLNYTDRTSGEQHHISLEGVFVQIGLVPNTEWLKGDIELSQHGEIIVNDRNETSI
PGVFAAGDATTVPYKQIVISMGEGSKAALSAFDFLIRNSVDESEDEAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory