SitesBLAST
Comparing GFF3691 FitnessBrowser__WCS417:GFF3691 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
24% identity, 87% coverage: 15:406/453 of query aligns to 4:400/430 of P0AA76
- Y29 (= Y40) binding
- D31 (= D42) mutation to N: Loss of galactonate transport activity.
- R32 (= R43) binding
- Y64 (= Y75) binding
- E118 (= E129) mutation to Q: Loss of galactonate transport activity.
- W358 (= W364) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
24% identity, 85% coverage: 23:406/453 of query aligns to 1:381/409 of 6e9nA
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 71% coverage: 15:334/453 of query aligns to 79:397/534 of P53322
- K283 (≠ R219) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
23% identity, 85% coverage: 23:406/453 of query aligns to 4:365/393 of 6e9oA
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
24% identity, 82% coverage: 61:430/453 of query aligns to 105:479/495 of Q9NRA2
- K136 (≠ R92) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ I137) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AI 152:153) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ LV 225:226) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ NAIDQ 227:231) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G292) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P298) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (≠ A321) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 77% coverage: 49:395/453 of query aligns to 90:441/495 of Q5Q0U0
- K136 (≠ R92) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R122) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L125) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G126) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E129) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A130) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (= F133) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P134) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ I137) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ F140) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ NAIDQ 227:231) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P298) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (≠ A321) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
22% identity, 77% coverage: 49:395/453 of query aligns to 90:441/495 of Q8BN82
- H183 (≠ I137) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
22% identity, 74% coverage: 69:404/453 of query aligns to 129:470/582 of Q9JI12
- R184 (= R122) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E129) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ I265) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
- 128 H→A: Greatly lowers L-glutamate transport.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
23% identity, 74% coverage: 69:404/453 of query aligns to 71:412/452 of 7t3nA
Sites not aligning to the query:
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
23% identity, 73% coverage: 71:401/453 of query aligns to 90:430/493 of Q03567
Sites not aligning to the query:
- 69 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
21% identity, 66% coverage: 10:307/453 of query aligns to 80:387/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
23% identity, 42% coverage: 102:290/453 of query aligns to 97:289/452 of Q5EXK5
Sites not aligning to the query:
- 82 D→A: Loss of activity.
- 311 V→W: Loss of activity.
- 314 D→A: Loss of activity.
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
23% identity, 60% coverage: 11:280/453 of query aligns to 97:347/605 of Q9GQQ0
- E217 (= E129) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 58% coverage: 53:315/453 of query aligns to 33:304/446 of A0A0H2VG78
- R102 (= R122) mutation to A: Loss of transport activity.
- I105 (≠ L125) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (≠ R142) mutation to A: Loss of transport activity.
- Q137 (≠ A163) mutation to A: Loss of transport activity.
- Q250 (= Q266) mutation to A: Loss of transport activity.
- Q251 (vs. gap) mutation to A: Loss of transport activity.
- N256 (≠ Y270) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 357 W→A: Loss of transport activity.
Query Sequence
>GFF3691 FitnessBrowser__WCS417:GFF3691
MNNSSHASAAPHRDPVLARAVSKVKSHVLPLFVIMFILNYIDRVNIGFVRTHMEHDLGIG
AAAYGFGAGLFFIGYALFEVPSNMLLQKVGARLWLTRIMFTWGIVATLMAFIQNETHFYI
LRFLLGVAEAGFFPGVIYYFTRWLPGAERGKAIAIFLSGSAVASLISGPLSGALLQIEGF
GFHGWQWMFAIEGLASVALGFFVWFWLDSKPHDAQWMTREEQDALVNAIDQEQRDREALT
TVKPTLGKLLKDRQILLFCALYFCIQLTIYAATFWLPSIIKKMGDLTDVQVGFFNSIPWL
ISIIAMYAFASLSGKFKFQQAWVAAALLIAAAGMFMSTTGGPIFAFVAICFAAIGFKSAS
SLFWPIPQGYLDVRIAAAVIALINSIGNLGGFVAPTTFGFLEQTTGSIQGGLYGLAGTSL
LAAILVFFAKTSPSAVPISPSAEPTNAALSKPL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory