SitesBLAST
Comparing GFF3692 FitnessBrowser__WCS417:GFF3692 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
74% identity, 100% coverage: 1:441/441 of query aligns to 5:446/446 of P0AES2
- Y150 (= Y146) mutation to F: Reduces activity 100-fold.
- K207 (= K203) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D231) binding
- E266 (= E262) binding
- N289 (= N285) binding
- H339 (= H335) active site, Proton acceptor; mutation to A: Loss of activity.; mutation to N: Reduces activity 10000-fold.; mutation to Q: Reduces activity 1000-fold.
- N341 (= N337) mutation to D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; mutation to L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- D366 (= D362) mutation D->A,N: Reduces activity over 100-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
74% identity, 100% coverage: 1:441/441 of query aligns to 3:444/444 of 1ecqA
- active site: K203 (= K201), K205 (= K203), D233 (= D231), N235 (= N233), E258 (= E256), N287 (= N285), M288 (= M286), D311 (= D309), H337 (= H335), N339 (= N337), I363 (= I361)
- binding 4-deoxyglucarate: N25 (= N23), H30 (= H28), T101 (= T99), Y148 (= Y146), F150 (= F148), K205 (= K203), D233 (= D231), N235 (= N233), N287 (= N285), H337 (= H335), S338 (= S336), N339 (= N337), H366 (= H364), R420 (= R417)
- binding magnesium ion: D233 (= D231), E258 (= E256), N287 (= N285)
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
74% identity, 100% coverage: 1:441/441 of query aligns to 3:444/444 of 1ec9D
- active site: K203 (= K201), K205 (= K203), D233 (= D231), N235 (= N233), E258 (= E256), N287 (= N285), M288 (= M286), D311 (= D309), H337 (= H335), N339 (= N337), I363 (= I361)
- binding magnesium ion: D233 (= D231), E258 (= E256), N287 (= N285)
- binding xylarohydroxamate: H30 (= H28), T101 (= T99), Y148 (= Y146), F150 (= F148), K205 (= K203), D233 (= D231), N235 (= N233), N287 (= N285), H337 (= H335), S338 (= S336), N339 (= N337), H366 (= H364), R420 (= R417)
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
74% identity, 100% coverage: 1:441/441 of query aligns to 1:442/442 of 1ec8A
- active site: K201 (= K201), K203 (= K203), D231 (= D231), N233 (= N233), E256 (= E256), N285 (= N285), M286 (= M286), D309 (= D309), H335 (= H335), N337 (= N337), I361 (= I361)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (= N23), H28 (= H28), T99 (= T99), Y146 (= Y146), K203 (= K203), D231 (= D231), N233 (= N233), N285 (= N285), H335 (= H335), S336 (= S336), N337 (= N337), H364 (= H364), R418 (= R417)
- binding magnesium ion: D231 (= D231), E256 (= E256), N285 (= N285)
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
74% identity, 100% coverage: 1:441/441 of query aligns to 2:443/443 of 1jctA
- active site: K202 (= K201), K204 (= K203), D232 (= D231), N234 (= N233), E257 (= E256), N286 (= N285), M287 (= M286), D310 (= D309), H336 (= H335), L338 (≠ N337), I362 (= I361)
- binding d-glucarate: N24 (= N23), H29 (= H28), T100 (= T99), Y147 (= Y146), F149 (= F148), K204 (= K203), D232 (= D231), N286 (= N285), S337 (= S336), R419 (= R417)
- binding magnesium ion: D232 (= D231), E257 (= E256), N286 (= N285)
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
67% identity, 99% coverage: 3:439/441 of query aligns to 2:428/428 of 3p0wB
- active site: K189 (= K201), K191 (= K203), D219 (= D231), N221 (= N233), E244 (= E256), N273 (= N285), D297 (= D309), H323 (= H335), N325 (= N337)
- binding d-glucarate: H27 (= H28), Y134 (= Y146), K191 (= K203), D219 (= D231), N221 (= N233), N273 (= N285), H323 (= H335), N325 (= N337), H352 (= H364), R406 (= R417)
- binding magnesium ion: D219 (= D231), E244 (= E256), N273 (= N285)
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
67% identity, 99% coverage: 3:439/441 of query aligns to 2:424/425 of 3nxlC
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
62% identity, 100% coverage: 2:441/441 of query aligns to 2:430/432 of 3n6hB
- active site: K189 (= K201), K191 (= K203), D219 (= D231), N221 (= N233), E244 (= E256), N273 (= N285), D297 (= D309), H323 (= H335), N325 (= N337)
- binding magnesium ion: D219 (= D231), E244 (= E256), N273 (= N285)
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
61% identity, 100% coverage: 2:441/441 of query aligns to 1:426/426 of 3pfrA
- active site: K185 (= K201), K187 (= K203), D215 (= D231), N217 (= N233), E240 (= E256), N269 (= N285), D293 (= D309), H319 (= H335), N321 (= N337)
- binding d-glucarate: N22 (= N23), H27 (= H28), Y130 (= Y146), F132 (= F148), K187 (= K203), D215 (= D231), N217 (= N233), N269 (= N285), H319 (= H335), S320 (= S336), N321 (= N337), H348 (= H364)
- binding magnesium ion: D215 (= D231), E240 (= E256), N269 (= N285)
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
57% identity, 99% coverage: 4:440/441 of query aligns to 3:440/441 of 3nfuA
- active site: K201 (= K201), K203 (= K203), D231 (= D231), N233 (= N233), E256 (= E256), N285 (= N285), D309 (= D309), H335 (= H335), N337 (= N337)
- binding magnesium ion: D231 (= D231), N233 (= N233), E256 (= E256), D257 (= D257), N285 (= N285)
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
36% identity, 97% coverage: 6:431/441 of query aligns to 6:421/427 of 4it1D
- active site: S51 (≠ V51), D54 (≠ G54), A98 (≠ R95), Y150 (= Y146), K194 (= K201), K196 (= K203), D224 (= D231), N226 (= N233), Y247 (= Y254), E249 (= E256), T271 (= T284), N272 (= N285), M273 (= M286), D296 (= D309), H323 (= H335), S324 (= S336), N325 (= N337), C349 (≠ I361), D350 (= D362)
- binding magnesium ion: D224 (= D231), E249 (= E256), N272 (= N285)
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
33% identity, 98% coverage: 5:437/441 of query aligns to 12:425/427 of 3va8A
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
34% identity, 97% coverage: 5:430/441 of query aligns to 3:413/420 of 3vc6A
- active site: D52 (≠ G54), H55 (≠ I57), Y146 (= Y146), K188 (= K201), K190 (= K203), D218 (= D231), N220 (= N233), E243 (= E256), N266 (= N285), M267 (= M286), D290 (= D309), H317 (= H335), S318 (= S336), N319 (= N337), H321 (= H339), C343 (≠ I361), D344 (= D362)
- binding magnesium ion: D218 (= D231), E243 (= E256), N266 (= N285)
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
23% identity, 84% coverage: 36:404/441 of query aligns to 29:369/373 of 3sjnA
- active site: S46 (≠ G53), L49 (≠ R56), T139 (≠ L147), K165 (= K201), G167 (≠ K203), M171 (≠ L207), D198 (= D231), A200 (≠ N233), E225 (= E256), I247 (≠ F274), G250 (≠ A277), E251 (≠ T278), S252 (≠ G279), Q272 (≠ A288), D274 (= D290), H301 (= H311), G302 (≠ F312), F303 (≠ W313), M325 (≠ T331), E326 (≠ W332), Q329 (≠ H335), S331 (= S343)
- binding magnesium ion: D198 (= D231), E225 (= E256), E251 (≠ T278)
3dg6A Crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone (see paper)
27% identity, 67% coverage: 108:403/441 of query aligns to 98:361/366 of 3dg6A
- active site: M134 (= M143), K160 (= K201), K162 (= K203), D191 (= D231), N193 (= N233), E217 (= E256), D242 (≠ K281), E243 (≠ T282), S244 (≠ A283), K266 (≠ P306), G292 (≠ N337), N293 (= N338), Q294 (≠ H339), G319 (≠ I361), E320 (≠ D362), L321 (≠ T363)
- binding magnesium ion: D191 (= D231), E217 (= E256), D242 (≠ K281)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: M134 (= M143), K160 (= K201), K162 (= K203), D191 (= D231), N193 (= N233), D242 (≠ K281), K266 (≠ P306), N293 (= N338), Q294 (≠ H339), I295 (≠ F340)
Sites not aligning to the query:
3rcyF Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from roseovarius sp. Tm1035
25% identity, 86% coverage: 36:414/441 of query aligns to 25:384/397 of 3rcyF
- active site: K165 (= K192), D167 (≠ K194), R175 (≠ K203), G208 (≠ D231), H210 (≠ N233), E234 (= E256), G259 (≠ N285), E260 (≠ M286), Q281 (≠ D309), A283 (≠ H311), H310 (= H335), A313 (≠ N338), L332 (≠ I358), E335 (≠ I361)
- binding magnesium ion: E234 (= E256), E260 (≠ M286)
- binding alpha-D-ribofuranose: R85 (≠ F100), P86 (≠ D101), P239 (≠ A261), A266 (≠ R292), E267 (= E293)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
24% identity, 67% coverage: 108:402/441 of query aligns to 87:345/351 of 5olcC
- active site: K148 (= K201), K150 (= K203), D178 (= D231), N180 (= N233), E204 (= E256), G229 (≠ N285), E230 (≠ A288), D253 (≠ H311), H280 (= H326), E304 (≠ D362), E309 (≠ H364)
- binding magnesium ion: D178 (= D231), E204 (= E256), E230 (≠ A288)
2gghC The mutant a68c-d72c-nlq of deinococcus radiodurans nacylamino acid racemase (see paper)
26% identity, 75% coverage: 79:407/441 of query aligns to 77:363/370 of 2gghC
- active site: Y95 (≠ F100), S137 (≠ Y146), K163 (= K201), K165 (= K203), R186 (= R227), T188 (= T229), D190 (= D231), N192 (= N233), E215 (= E256), D240 (≠ K281), E241 (≠ T282), S242 (≠ A283), K264 (≠ Q301), C290 (vs. gap), G291 (vs. gap), G292 (vs. gap), M293 (vs. gap), G316 (= G356), D317 (= D357), T318 (≠ I358)
- binding magnesium ion: D190 (= D231), E215 (= E256)
- binding n~2~-acetyl-l-glutamine: G292 (vs. gap), M293 (vs. gap), L294 (vs. gap)
Sites not aligning to the query:
3u4fA Crystal structure of a mandelate racemase (muconate lactonizing enzyme family protein) from roseovarius nubinhibens
26% identity, 68% coverage: 108:405/441 of query aligns to 86:364/371 of 3u4fA
- active site: S122 (≠ L158), K150 (= K201), R152 (≠ K203), D162 (vs. gap), D188 (= D231), N190 (= N233), F213 (≠ A255), E214 (= E256), D235 (≠ R276), G239 (≠ L280), E240 (≠ K281), Q261 (≠ D309), D263 (≠ H311), H290 (= H335), A292 (≠ N337), N293 (= N338), K313 (≠ D357), E316 (≠ A360), I319 (vs. gap), G321 (vs. gap)
- binding magnesium ion: D188 (= D231), E214 (= E256), S229 (≠ M271), L232 (≠ F274), E240 (≠ K281)
Sites not aligning to the query:
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
25% identity, 84% coverage: 36:404/441 of query aligns to 33:372/378 of 4hpnA
- active site: G50 (= G53), R53 (= R56), T134 (= T156), K164 (= K201), K166 (= K203), D194 (= D231), N196 (= N233), E220 (= E256), G245 (≠ N285), E246 (≠ M286), T247 (≠ I287), Q267 (≠ L307), D269 (= D309), H296 (= H326), V297 (≠ E327), W298 (= W328), R320 (≠ A352), E329 (≠ A360), F330 (≠ I361), H334 (= H364)
- binding calcium ion: D194 (= D231), D209 (vs. gap), E220 (= E256), G237 (≠ A277), E246 (≠ M286)
Sites not aligning to the query:
Query Sequence
>GFF3692 FitnessBrowser__WCS417:GFF3692
MTTPVVTHFQVIPVAGHDSMLLNLSGAHGPYFTRNIVILKDSSGNTGVGEVPGGERIRET
LEDARSLVIGQPIGQYQRILNQMRSTFASRDAAGRGLQTFDLRITIHAVTAMEAALLDLL
GQFLDVPVAALLGEGQQRDAVKMLGYLFYVGDRSATPLAYRNEADSDDEWFRLRHETALT
ADAVVRLAEAAKAKYGFNDFKLKGGVLSGDEEIQAVTALAERFPDARITLDPNGAWSLKE
AIRLCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRATGLKTATNMIATDWREMGHAIQL
QSVDIPLADPHFWTLQGSVRVAQMCHEWGLTWGSHSNNHFDISLAMFTQVAAAAPGDITA
IDTHWIWQDGQHLTKAPLKIEGGYVKVPNKPGLGVEIDMDAVAKAHEVYKGMGLGARDDS
VAMQFLIPGWRFNNKQPCLVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory