Comparing GFF3695 FitnessBrowser__psRCH2:GFF3695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
60% identity, 99% coverage: 4:414/415 of query aligns to 3:417/418 of 4xg1B
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
55% identity, 99% coverage: 4:414/415 of query aligns to 3:392/393 of 4xg1A
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
43% identity, 93% coverage: 21:407/415 of query aligns to 7:395/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
43% identity, 93% coverage: 21:407/415 of query aligns to 5:387/394 of 3c5qA
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
40% identity, 98% coverage: 7:414/415 of query aligns to 10:431/434 of 1tufA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
40% identity, 98% coverage: 7:414/415 of query aligns to 14:435/438 of Q58497
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
40% identity, 98% coverage: 7:414/415 of query aligns to 10:431/434 of 1twiA
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
36% identity, 96% coverage: 8:405/415 of query aligns to 10:414/422 of 6n2aA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
40% identity, 94% coverage: 18:407/415 of query aligns to 4:381/386 of Q9X1K5
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
40% identity, 94% coverage: 18:407/415 of query aligns to 3:380/385 of 2yxxA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
34% identity, 97% coverage: 9:410/415 of query aligns to 22:445/447 of P9WIU7
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
34% identity, 97% coverage: 9:410/415 of query aligns to 21:444/446 of 1hkvA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
34% identity, 99% coverage: 3:411/415 of query aligns to 17:443/443 of 5x7mA
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
34% identity, 98% coverage: 3:410/415 of query aligns to 17:442/442 of 5x7nA
1knwA Crystal structure of diaminopimelate decarboxylase
34% identity, 95% coverage: 8:403/415 of query aligns to 8:410/421 of 1knwA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
34% identity, 95% coverage: 8:403/415 of query aligns to 9:411/420 of P00861
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
34% identity, 95% coverage: 8:403/415 of query aligns to 8:410/419 of 1ko0A
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
31% identity, 86% coverage: 18:375/415 of query aligns to 8:374/412 of 7ru7A
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
29% identity, 97% coverage: 4:405/415 of query aligns to 23:449/461 of 8d5rA
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
29% identity, 97% coverage: 4:405/415 of query aligns to 23:451/462 of 8d4iA
>GFF3695 FitnessBrowser__psRCH2:GFF3695
MEAFSYRDGQLFAEGVALPALAQRFGTPTYVYSRAHIEAQYRAYADALDGMPHLVCFAVK
ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGQPDRIVFSGVGKTRDDMRRALEVGVH
CFNVESTDELERLQQVAAELGKKAPVSLRVNPDVDAGTHPYISTGLKENKFGIDIDNAEA
VYARAAELPNLEVVGVDCHIGSQLTSLPPFLDALDRLLALTDRLAARGIQIRHLDLGGGL
GVRYRDEQPPLAGDYIQAVRQRIEGRGLALVFEPGRSIVANAGVLLTRVEYLKHTAHKDF
AIVDAAMNDLIRPALYQAWMNVIAVQPHEGDTRRYDIVGPICETGDFLAKDRELALVEGD
LLAVCSAGAYGFVMSSNYNTRGRAAEVLVDGDQAFEVRRRESVQELYAGESLLPT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory