Comparing GFF3697 FitnessBrowser__Phaeo:GFF3697 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
41% identity, 95% coverage: 3:315/330 of query aligns to 4:317/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
41% identity, 95% coverage: 3:315/330 of query aligns to 3:306/310 of 4fwiB
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
36% identity, 95% coverage: 1:315/330 of query aligns to 1:322/330 of P0AAH4
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
35% identity, 78% coverage: 3:260/330 of query aligns to 3:250/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
35% identity, 78% coverage: 3:260/330 of query aligns to 3:250/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
35% identity, 78% coverage: 3:260/330 of query aligns to 3:250/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 79% coverage: 3:263/330 of query aligns to 1:250/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 79% coverage: 3:263/330 of query aligns to 2:251/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 79% coverage: 3:263/330 of query aligns to 2:251/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 79% coverage: 3:263/330 of query aligns to 2:251/344 of 3tuiC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
34% identity, 70% coverage: 3:232/330 of query aligns to 2:220/222 of 7arlD
7mdyC Lolcde nucleotide-bound
34% identity, 70% coverage: 3:232/330 of query aligns to 2:220/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
34% identity, 70% coverage: 3:232/330 of query aligns to 5:223/233 of P75957
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 69% coverage: 27:254/330 of query aligns to 46:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 69% coverage: 27:254/330 of query aligns to 46:263/382 of 7aheC
Sites not aligning to the query:
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
34% identity, 70% coverage: 3:232/330 of query aligns to 4:222/229 of 7v8iD
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
32% identity, 70% coverage: 3:232/330 of query aligns to 1:223/232 of 1f3oA
7ahdC Opua (e190q) occluded (see paper)
32% identity, 68% coverage: 27:251/330 of query aligns to 46:260/260 of 7ahdC
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 78% coverage: 1:257/330 of query aligns to 1:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 78% coverage: 1:257/330 of query aligns to 1:241/242 of 3c41J
>GFF3697 FitnessBrowser__Phaeo:GFF3697
MSLLSVRDLTVKFAMRDHTVTALNQISFDLGKGERLGIVGESGAGKSITGFSLMNLLSRP
GFIDSGQILFGDKDIVKLSDAEMRKIRGNRMAMIFQDPMVTLNPVLTIGQQMVETLKAHR
SLSKAEAEQIAILKLREVYIPSPEERLNQYPHELSGGMRQRIIIAMALLLDPELIIADEP
TTALDVTIQADIMELLLELCQSNKVGLILITHDLGVVSQMTERTLVMYAGRLIEAGPTRE
IINDPQHPYTQGLINALPQQTLPGQRLKQIPGNMPGLASIPPGCPFSPRCEYAVDHCRKV
LPETVSYRQVEVACHEVSRLQNASLEEASV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory