Comparing GFF3700 FitnessBrowser__WCS417:GFF3700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
52% identity, 48% coverage: 261:502/505 of query aligns to 8:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
52% identity, 48% coverage: 261:502/505 of query aligns to 8:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
52% identity, 48% coverage: 261:502/505 of query aligns to 8:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
52% identity, 48% coverage: 261:502/505 of query aligns to 8:241/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
49% identity, 49% coverage: 255:502/505 of query aligns to 1:239/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
48% identity, 48% coverage: 262:502/505 of query aligns to 7:239/240 of 4ymuJ
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
47% identity, 49% coverage: 254:500/505 of query aligns to 4:254/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
47% identity, 48% coverage: 257:500/505 of query aligns to 3:250/258 of 1b0uA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 48% coverage: 242:484/505 of query aligns to 3:232/378 of P69874
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 44% coverage: 263:483/505 of query aligns to 12:224/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 44% coverage: 263:483/505 of query aligns to 13:225/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 44% coverage: 263:483/505 of query aligns to 13:225/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 44% coverage: 263:483/505 of query aligns to 13:225/344 of 3tuiC
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
42% identity, 42% coverage: 269:478/505 of query aligns to 18:223/232 of 1f3oA
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
41% identity, 42% coverage: 269:478/505 of query aligns to 18:223/230 of 1l2tA
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
36% identity, 47% coverage: 267:501/505 of query aligns to 18:242/615 of 5lilA
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
36% identity, 47% coverage: 267:501/505 of query aligns to 18:242/592 of 5lj7A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
37% identity, 45% coverage: 255:479/505 of query aligns to 3:222/648 of P75831
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 46% coverage: 274:503/505 of query aligns to 44:267/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
37% identity, 46% coverage: 274:503/505 of query aligns to 44:267/382 of 7aheC
Sites not aligning to the query:
>GFF3700 FitnessBrowser__WCS417:GFF3700
MTFDWNYMFGLLGDAEFWRATWTVIKLSTLTWVLSIGLGFLLALAKQSRHGLLSVPARGY
IWLFRSLPLLVLLIFIYNLPQALPGTSAILADPFWSGLLALVICETAYVAEIHRGGLLSI
PKGQAEAARALGLKFFGTQWRVVIPQALRVALPSLANEYISIVKLTSLVSVISLTEILMV
GQRLYSQNFLVIETMAAVAFFYVFIVTVFDFLLKRLERFLDVNERNVSRVPDAAVLALAS
QQRTALARPATHGEPALQAARLHKAYNDIEVLGSVNLQIQPGEVVSVIGPSGSGKTTLIR
LLNGLEQLDNGEIRINGQPFIHLNKVGAQKPQYIEHAEHRLNIGMVFQSFNLFPHLTVLD
NLLMAPKYHRLGATAELKQQAYALLHKVGMLDHAWKYPHQLSGGQQQRVAIARALMMRPQ
IMLFDEPTSALDPEKVNEVLQVIEALAEEGITMVIVTHEMNFAFKVSDRIVFMEKGSVVC
DDTPGALRSGHNPRVEAFLKDVSLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory