SitesBLAST
Comparing GFF3712 FitnessBrowser__psRCH2:GFF3712 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zz7A Crystal structure of methylmalonate-semialdehyde dehydrogenase (dddc) from oceanimonas doudoroffii (see paper)
61% identity, 98% coverage: 1:491/500 of query aligns to 1:489/489 of 4zz7A
- active site: N149 (= N150), K172 (= K173), L246 (= L247), C280 (= C281), E382 (= E385), A462 (≠ M465)
- binding nicotinamide-adenine-dinucleotide: T146 (= T147), P147 (= P148), F148 (= F149), N149 (= N150), K172 (= K173), E175 (= E176), K205 (= K206), V208 (= V209), F222 (= F223), V223 (= V224), G224 (= G225), S225 (= S226), I228 (= I229), L246 (= L247), G247 (= G248), C280 (= C281), E382 (= E385), F384 (= F387)
5tjrD X-ray crystal structure of a methylmalonate semialdehyde dehydrogenase from pseudomonas sp. Aac (see paper)
59% identity, 96% coverage: 4:485/500 of query aligns to 3:456/468 of 5tjrD
- active site: N144 (= N150), K167 (= K173), L241 (= L247), C270 (= C281), E356 (= E385), A436 (≠ M465)
- binding adenosine-5'-diphosphate: I140 (= I146), T141 (= T147), F143 (= F149), K167 (= K173), E170 (= E176), K200 (= K206), F217 (= F223), S220 (= S226), I223 (= I229)
4iymC Crystal structure of putative methylmalonate-semialdehyde dehydrogenase from sinorhizobium meliloti 1021 complexed with NAD, target 011934
55% identity, 98% coverage: 1:489/500 of query aligns to 4:490/491 of 4iymC
- active site: N153 (= N150), K176 (= K173), F250 (≠ L247), C284 (= C281), E386 (= E385), Q466 (≠ M465)
- binding nicotinamide-adenine-dinucleotide: I149 (= I146), T150 (= T147), P151 (= P148), F152 (= F149), N153 (= N150), F154 (= F151), K176 (= K173), K209 (= K206), V212 (= V209), F226 (= F223), V227 (= V224), G228 (= G225), S229 (= S226), I232 (= I229), G251 (= G248), C284 (= C281), E386 (= E385), F388 (= F387)
P42412 Malonate-semialdehyde dehydrogenase; MSA dehydrogenase; Methylmalonate-semialdehyde dehydrogenase; MMSA dehydrogenase; MMSDH; MSDH; EC 1.2.1.27 from Bacillus subtilis (strain 168) (see 3 papers)
44% identity, 97% coverage: 1:485/500 of query aligns to 4:482/487 of P42412
- C36 (≠ L33) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-160; A-287; A-351 and A-413.
- R107 (= R104) mutation to L: At least 50-fold decrease of the second-order rate constant for the acylation step.
- A150 (≠ T147) binding
- F152 (= F149) binding
- C160 (≠ L157) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-287; A-351 and A-413.
- K176 (= K173) binding
- E179 (= E176) binding
- R180 (≠ K177) binding
- S229 (= S226) binding
- T251 (≠ G248) binding
- R283 (= R280) mutation to L: At least 50-fold decrease of the second-order rate constant for the acylation step.
- C287 (≠ I284) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-351 and A-413.
- C351 (= C351) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-287 and A-413.
- E382 (= E385) binding
- C413 (≠ S416) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-287 and A-351.
1t90A Crystal structure of methylmalonate semialdehyde dehydrogenase from bacillus subtilis
44% identity, 97% coverage: 1:485/500 of query aligns to 2:480/484 of 1t90A
- active site: N151 (= N150), K174 (= K173), L248 (= L247), C282 (= C281), E380 (= E385), A460 (≠ M465)
- binding nicotinamide-adenine-dinucleotide: I147 (= I146), A148 (≠ T147), P149 (= P148), F150 (= F149), N151 (= N150), W159 (= W158), K174 (= K173), E177 (= E176), R178 (≠ K177), H207 (≠ K206), V225 (= V224), G226 (= G225), S227 (= S226), V230 (≠ I229), L248 (= L247), T249 (≠ G248), C282 (= C281), E380 (= E385), F382 (= F387)
7w5nA The crystal structure of the reduced form of gluconobacter oxydans wsh-004 sndh (see paper)
33% identity, 96% coverage: 2:480/500 of query aligns to 9:480/492 of 7w5nA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: W156 (≠ F149), K180 (= K173), A182 (≠ S175), T212 (≠ D205), G213 (≠ K206), G217 (≠ D210), F231 (= F223), G233 (= G225), S234 (= S226), V237 (≠ I229), Q337 (≠ H331), E388 (= E385), F390 (= F387)
7w5kA The c296a mutant of l-sorbosone dehydrogenase (sndh) from gluconobacter oxydans wsh-004 (see paper)
33% identity, 96% coverage: 2:480/500 of query aligns to 8:479/491 of 7w5kA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I152 (= I146), T153 (= T147), P154 (= P148), W155 (≠ F149), N156 (= N150), I161 (≠ V155), K179 (= K173), A181 (≠ S175), E182 (= E176), T211 (≠ D205), G212 (≠ K206), G216 (≠ D210), Q217 (≠ V211), F230 (= F223), T231 (≠ V224), G232 (= G225), S233 (= S226), V236 (≠ I229), E255 (≠ L247), L256 (≠ G248), G257 (= G249), A289 (≠ M282), E387 (= E385), F389 (= F387)
1bpwA Betaine aldehyde dehydrogenase from cod liver (see paper)
30% identity, 92% coverage: 23:480/500 of query aligns to 40:492/503 of 1bpwA
- active site: N166 (= N150), K189 (= K173), E263 (≠ L247), C297 (= C281), E400 (= E385), E477 (≠ L463)
- binding nicotinamide-adenine-dinucleotide: I162 (= I146), L163 (≠ T147), W165 (≠ F149), N166 (= N150), K189 (= K173), G221 (≠ D205), G225 (≠ V209), T240 (≠ V224), G241 (= G225), S242 (= S226), T245 (≠ I229), E263 (≠ L247), L264 (≠ G248), C297 (= C281), E400 (= E385), F402 (= F387), F466 (= F452)
P56533 4-trimethylaminobutyraldehyde dehydrogenase; TMABA-DH; TMABADH; Aldehyde dehydrogenase family 9 member A1; Betaine aldehyde dehydrogenase; BADH; EC 1.2.1.47; EC 1.2.1.3 from Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias) (see paper)
30% identity, 92% coverage: 23:480/500 of query aligns to 40:492/503 of P56533
7radA Crystal structure analysis of aldh1b1
32% identity, 96% coverage: 7:485/500 of query aligns to 16:489/493 of 7radA
- binding nicotinamide-adenine-dinucleotide: I158 (= I146), I159 (≠ T147), P160 (= P148), W161 (≠ F149), N162 (= N150), M167 (≠ V155), K185 (= K173), E188 (= E176), G218 (≠ K206), G222 (≠ D210), A223 (≠ V211), T237 (≠ V224), G238 (= G225), S239 (= S226), V242 (≠ I229), E261 (≠ L247), L262 (≠ G248), C295 (= C281), E392 (= E385), F394 (= F387)
- binding 3-(2-methoxyphenyl)-1-(4-phenylphenyl)-6,7,8,9-tetrahydro-5~{H}-imidazo[1,2-a][1,3]diazepine: L113 (vs. gap), E117 (≠ R104), F163 (= F151), E285 (≠ G271), F289 (≠ G275), N450 (≠ P444), V452 (≠ P446)
7mjdA Crystal structure analysis of aldh1b1
32% identity, 96% coverage: 7:485/500 of query aligns to 16:489/493 of 7mjdA
- binding nicotinamide-adenine-dinucleotide: I158 (= I146), I159 (≠ T147), P160 (= P148), W161 (≠ F149), N162 (= N150), M167 (≠ V155), K185 (= K173), E188 (= E176), G218 (≠ K206), G222 (≠ D210), F236 (= F223), T237 (≠ V224), G238 (= G225), S239 (= S226), V242 (≠ I229), E261 (≠ L247), L262 (≠ G248), C295 (= C281), E392 (= E385), F394 (= F387)
- binding 8-(2-methoxyphenyl)-10-(4-phenylphenyl)-1$l^{4},8-diazabicyclo[5.3.0]deca-1(7),9-diene: E117 (≠ R104), E285 (≠ G271), F289 (≠ G275), N450 (≠ P444), V452 (≠ P446)
7mjcA Crystal structure analysis of aldh1b1
32% identity, 96% coverage: 7:485/500 of query aligns to 16:489/493 of 7mjcA
- binding nicotinamide-adenine-dinucleotide: I158 (= I146), I159 (≠ T147), P160 (= P148), W161 (≠ F149), N162 (= N150), K185 (= K173), E188 (= E176), G218 (≠ K206), G222 (≠ D210), T237 (≠ V224), G238 (= G225), S239 (= S226), V242 (≠ I229), E261 (≠ L247), L262 (≠ G248), C295 (= C281), E392 (= E385), F394 (= F387)
4neaA 1.90 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) from staphylococcus aureus in complex with NAD+ and bme-free cys289 (see paper)
30% identity, 91% coverage: 8:461/500 of query aligns to 22:474/505 of 4neaA
- active site: N166 (= N150), K189 (= K173), E264 (≠ L247), C298 (= C281), E399 (= E385)
- binding nicotinamide-adenine-dinucleotide: P164 (= P148), K189 (= K173), E192 (= E176), G222 (≠ D205), G226 (≠ V209), G242 (= G225), G243 (≠ S226), T246 (≠ I229), H249 (≠ Y232), I250 (= I233), C298 (= C281), E399 (= E385), F401 (= F387)
Sites not aligning to the query:
2d4eC Crystal structure of the hpcc from thermus thermophilus hb8
32% identity, 95% coverage: 6:480/500 of query aligns to 29:501/515 of 2d4eC
- active site: N173 (= N150), K196 (= K173), E271 (≠ L247), C305 (= C281), E409 (= E385), E486 (≠ M465)
- binding nicotinamide-adenine-dinucleotide: I169 (= I146), T170 (= T147), P171 (= P148), W172 (≠ F149), K196 (= K173), A198 (≠ S175), G229 (≠ D205), G233 (≠ V209), A234 (≠ D210), T248 (≠ V224), G249 (= G225), E250 (≠ S226), T253 (≠ I229), E271 (≠ L247), L272 (≠ G248), C305 (= C281), E409 (= E385), F411 (= F387), F475 (= F452)
6vr6D Structure of aldh9a1 complexed with NAD+ in space group p1 (see paper)
29% identity, 91% coverage: 24:480/500 of query aligns to 31:482/493 of 6vr6D
- active site: N156 (= N150), E253 (≠ L247), C287 (= C281), E467 (≠ L463)
- binding nicotinamide-adenine-dinucleotide: I152 (= I146), G153 (≠ T147), W155 (≠ F149), K179 (= K173), A212 (≠ K206), G215 (≠ V209), Q216 (≠ D210), F229 (= F223), G231 (= G225), S232 (= S226), T235 (≠ I229), I239 (= I233)
5gtlA NADPH complex structure of aldehyde dehydrogenase from bacillus cereus
30% identity, 95% coverage: 7:480/500 of query aligns to 20:486/491 of 5gtlA
- active site: N165 (= N150), K188 (= K173), E263 (≠ L247), C297 (= C281), E394 (= E385), E471 (≠ P462)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I161 (= I146), P163 (= P148), K188 (= K173), A190 (≠ S175), E191 (= E176), Q192 (≠ K177), G221 (≠ D205), G225 (≠ V209), G241 (= G225), S242 (= S226), T245 (≠ I229), L264 (≠ G248), C297 (= C281), E394 (= E385), F396 (= F387)
5gtkA NAD+ complex structure of aldehyde dehydrogenase from bacillus cereus
30% identity, 95% coverage: 7:480/500 of query aligns to 20:486/491 of 5gtkA
- active site: N165 (= N150), K188 (= K173), E263 (≠ L247), C297 (= C281), E394 (= E385), E471 (≠ P462)
- binding nicotinamide-adenine-dinucleotide: I161 (= I146), I162 (≠ T147), P163 (= P148), W164 (≠ F149), K188 (= K173), E191 (= E176), G221 (≠ D205), G225 (≠ V209), A226 (≠ D210), F239 (= F223), G241 (= G225), S242 (= S226), T245 (≠ I229), Y248 (= Y232), L264 (≠ G248), C297 (= C281), Q344 (≠ H331), R347 (≠ K334), E394 (= E385), F396 (= F387)
P49189 4-trimethylaminobutyraldehyde dehydrogenase; TMABA-DH; TMABALDH; Aldehyde dehydrogenase E3 isozyme; Aldehyde dehydrogenase family 9 member A1; Formaldehyde dehydrogenase; Gamma-aminobutyraldehyde dehydrogenase; R-aminobutyraldehyde dehydrogenase; EC 1.2.1.47; EC 1.2.1.3; EC 1.2.1.46; EC 1.2.1.19 from Homo sapiens (Human) (see 2 papers)
29% identity, 91% coverage: 24:480/500 of query aligns to 32:483/494 of P49189
- C116 (≠ V108) to S: in allele ALDH9A1*2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; alternate
- 2 modified: N-acetylserine; in 4-trimethylaminobutyraldehyde dehydrogenase, N-terminally processed
6x9lA Crystal structure of aldehyde dehydrogenasE C (aldc) mutant (c291a) from pseudomonas syringae in complexed with NAD+ and octanal (see paper)
36% identity, 87% coverage: 23:458/500 of query aligns to 31:457/485 of 6x9lA
- active site: N154 (= N150), E252 (≠ L247), A286 (≠ C281)
- binding nicotinamide-adenine-dinucleotide: I150 (= I146), T151 (= T147), W153 (≠ F149), N154 (= N150), Q159 (≠ V155), K177 (= K173), E180 (= E176), G210 (vs. gap), P211 (≠ K206), G214 (≠ V209), T229 (≠ V224), G230 (= G225), S231 (= S226), E252 (≠ L247), L253 (≠ G248), A286 (≠ C281), E386 (= E385), F388 (= F387), F451 (= F452)
- binding octanal: W155 (≠ F151), S285 (≠ R280)
Sites not aligning to the query:
7a6qB Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
31% identity, 95% coverage: 7:481/500 of query aligns to 17:486/489 of 7a6qB
- active site: N163 (= N150), E262 (≠ L247), C296 (= C281), E470 (≠ M465)
- binding nicotinamide-adenine-dinucleotide: I159 (= I146), W162 (≠ F149), K186 (= K173), E189 (= E176), G219 (≠ K206), G223 (≠ D210), S240 (= S226), V243 (≠ I229), K342 (≠ E330)
- binding (3-oxidanylidene-3-sodiooxy-propanoyl)oxysodium: A32 (≠ T22), T33 (≠ V23), C34 (≠ Y24), P36 (= P26), D103 (≠ E90), E189 (= E176), Q190 (≠ K177), F218 (≠ D205), I339 (≠ V327), D340 (≠ T328)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (= G105), D141 (≠ G128), N143 (≠ D130), N451 (≠ I443), L453 (≠ V445), A455 (= A448)
Query Sequence
>GFF3712 FitnessBrowser__psRCH2:GFF3712
MQTLGNLINNEAVAGRSERHATVYNPANGEPRLYVSLSSADETREAIAAAQAAFDGWSKT
PPLVRARVMFRFKELLERRRDDVARLITSEHGKVFSDAQGEVTRGLEVVEFACGIPHLLK
GEFSSNVGRDIDSNSLMQPLGVCVGITPFNFPAMVPLWMLPVAIACGNTFVLKPSEKDPS
ATMLLGELLAEAGLPAGVLNIVNGDKEAVDVLLTDERVQSVSFVGSTPIAEYIYATASAH
GKRCQALGGAKNHMVVMPDADPQQVVSSLIGAAYGSAGERCMAISVAVCVGDEVADKLVG
MLQDEIGQMRTGPGLGIEPEPHMGPLVTREHQQKVSGYIDLGVEEGATLVCDGRGIKVEG
HENGFYVGPTLFDRVTPSMRIYREEIFGPVLAVVRVKSFDEALQLINDHEYGNGTSIFTR
DGDTARQFEENVKVGMVGVNVPIPVPMAFHCFGGWKRSVFGPLNMHGPDGVRFFTRMKTV
TRRWPTGIRAGAEFAMPTMK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory