Comparing GFF3713 FitnessBrowser__Marino:GFF3713 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 95% coverage: 13:252/253 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 95% coverage: 13:252/253 of query aligns to 4:253/253 of 1g9xB
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
31% identity, 96% coverage: 11:252/253 of query aligns to 4:238/240 of 1ji0A
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 91% coverage: 13:243/253 of query aligns to 4:230/280 of 5x40A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 95% coverage: 13:252/253 of query aligns to 2:235/240 of 6mjpA
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
31% identity, 92% coverage: 16:249/253 of query aligns to 9:225/353 of 1vciA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 92% coverage: 13:245/253 of query aligns to 17:240/378 of P69874
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 88% coverage: 28:249/253 of query aligns to 20:237/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 88% coverage: 28:249/253 of query aligns to 20:237/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 88% coverage: 28:249/253 of query aligns to 20:237/353 of 1oxuA
Sites not aligning to the query:
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 88% coverage: 28:249/253 of query aligns to 20:237/353 of Q97UY8
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
31% identity, 91% coverage: 13:241/253 of query aligns to 4:224/285 of 4yerA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
29% identity, 88% coverage: 23:244/253 of query aligns to 16:234/375 of 2d62A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 94% coverage: 14:252/253 of query aligns to 3:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 94% coverage: 14:252/253 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 94% coverage: 14:252/253 of query aligns to 3:235/238 of 6s8gA
Q9BZC7 ATP-binding cassette sub-family A member 2; ATP-binding cassette transporter 2; ATP-binding cassette 2; EC 7.6.2.- from Homo sapiens (Human) (see paper)
29% identity, 91% coverage: 13:242/253 of query aligns to 2049:2274/2435 of Q9BZC7
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 87% coverage: 24:244/253 of query aligns to 15:226/393 of P9WQI3
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 94% coverage: 14:252/253 of query aligns to 4:236/241 of 6mbnA
3d31A Modbc from methanosarcina acetivorans (see paper)
31% identity, 92% coverage: 13:244/253 of query aligns to 1:219/348 of 3d31A
Sites not aligning to the query:
>GFF3713 FitnessBrowser__Marino:GFF3713
MMSAAKSKSGDFLLAVEGLTVSFDGFKAVDDLSFYLDPKEIRVIIGPNGAGKTTVLDLIC
GKTKATSGSIKFDGKELTKLKEHQIVHSGVGRKFQTPSVFEDLTVFENLEVSYPKGHSVM
GALGFKRDAEVISAVEEVAETIFLTEALNEPAASLSHGQKQWLEIGMLLIQKPDLLMLDE
PVAGMSVTERKKTAELLRVITRDHTVLVIEHDMQFVGDIADRVTVMHQGKVLSEGSIEHV
KSDPKVIEVYLGH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory