SitesBLAST
Comparing GFF3716 FitnessBrowser__psRCH2:GFF3716 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
42% identity, 94% coverage: 9:486/511 of query aligns to 4:507/535 of 3wy2A
- active site: D97 (= D102), R197 (= R197), D199 (= D199), E268 (= E254), H329 (= H316), D330 (= D317)
- binding beta-D-glucopyranose: D59 (= D64), Y62 (= Y67), H102 (= H107), R197 (= R197), D199 (= D199), E268 (= E254), H329 (= H316), D330 (= D317), R397 (= R372)
- binding glycerol: S101 (≠ N106), D169 (= D169), V170 (≠ L170), P175 (= P175), R178 (≠ V178), Q179 (≠ E179), F203 (≠ C203), Y204 (≠ T204), H206 (≠ K206), D240 (vs. gap), P244 (vs. gap), E280 (≠ Q265)
- binding magnesium ion: D20 (= D25), R22 (≠ N27), V26 (≠ I31), D28 (= D33)
3wy1A Crystal structure of alpha-glucosidase (see paper)
42% identity, 94% coverage: 9:486/511 of query aligns to 4:507/535 of 3wy1A
- active site: D97 (= D102), R197 (= R197), D199 (= D199), E268 (= E254), H329 (= H316), D330 (= D317)
- binding glycerol: S101 (≠ N106), D169 (= D169), V170 (≠ L170), F203 (≠ C203), Y204 (≠ T204), H206 (≠ K206)
- binding magnesium ion: D20 (= D25), D24 (= D29), V26 (≠ I31), D28 (= D33)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D64), Y62 (= Y67), H102 (= H107), F144 (≠ L143), F163 (= F163), R197 (= R197), D199 (= D199), T200 (≠ V200), G225 (≠ S223), E268 (= E254), F294 (= F279), H329 (= H316), D330 (= D317), R397 (= R372)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
42% identity, 94% coverage: 9:486/511 of query aligns to 4:507/535 of 3wy4A
- active site: D97 (= D102), R197 (= R197), D199 (= D199), Q268 (≠ E254), H329 (= H316), D330 (= D317)
- binding alpha-D-glucopyranose: D59 (= D64), Y62 (= Y67), H102 (= H107), I143 (≠ A142), F163 (= F163), D199 (= D199), T200 (≠ V200), G225 (≠ S223), Q268 (≠ E254), Q268 (≠ E254), F294 (= F279), H329 (= H316), D330 (= D317), R397 (= R372), R397 (= R372)
- binding glycerol: S101 (≠ N106), D169 (= D169), V170 (≠ L170), F203 (≠ C203), Y204 (≠ T204), H206 (≠ K206), L224 (= L222), G225 (≠ S223), A226 (≠ D224), P227 (≠ F225), F294 (= F279), D330 (= D317), E374 (≠ D358), K395 (≠ G370), G396 (= G371), G399 (= G374)
- binding magnesium ion: D20 (= D25), D24 (= D29), V26 (≠ I31), D28 (= D33)
2ze0A Alpha-glucosidase gsj (see paper)
42% identity, 92% coverage: 6:477/511 of query aligns to 1:493/531 of 2ze0A
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
39% identity, 91% coverage: 7:469/511 of query aligns to 2:516/561 of O06994
- D20 (= D25) binding
- N22 (= N27) binding
- D24 (= D29) binding
- F26 (≠ I31) binding
- D28 (= D33) binding
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
39% identity, 90% coverage: 9:469/511 of query aligns to 2:514/559 of 7lv6B
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
39% identity, 90% coverage: 9:469/511 of query aligns to 2:511/555 of 4m56A
- active site: D95 (= D102), R195 (= R197), D197 (= D199), E250 (= E254), H326 (= H316), D327 (= D317)
- binding D-glucose: D57 (= D64), Y60 (= Y67), H100 (= H107), F142 (≠ G144), D197 (= D199), E250 (= E254), D327 (= D317), R413 (= R372)
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
39% identity, 90% coverage: 9:469/511 of query aligns to 2:511/556 of 5wczA
- active site: D95 (= D102), R195 (= R197), D197 (= D199), E250 (= E254), H326 (= H316), D327 (= D317)
- binding 1-deoxynojirimycin: D57 (= D64), Y60 (= Y67), H100 (= H107), F161 (= F163), D197 (= D199), V198 (= V200), E250 (= E254), H326 (= H316), D327 (= D317), R413 (= R372)
5do8B 1.8 angstrom crystal structure of listeria monocytogenes lmo0184 alpha-1,6-glucosidase (see paper)
37% identity, 98% coverage: 9:507/511 of query aligns to 4:549/553 of 5do8B
- active site: D97 (= D102), R193 (= R197), D195 (= D199), E252 (= E254), H325 (= H316), D326 (= D317)
- binding beta-D-glucopyranose: D59 (= D64), Y62 (= Y67), H102 (= H107), F159 (= F163), R193 (= R197), D195 (= D199), E252 (= E254), H325 (= H316), D326 (= D317), R411 (= R372)
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
38% identity, 90% coverage: 9:469/511 of query aligns to 2:514/559 of 4mazA
4howA The crystal structure of isomaltulose synthase from erwinia rhapontici nx5 (see paper)
38% identity, 93% coverage: 9:481/511 of query aligns to 6:525/559 of 4howA
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
37% identity, 90% coverage: 9:467/511 of query aligns to 3:501/546 of 8ibkA
- binding calcium ion: D19 (= D25), N21 (= N27), D23 (= D29), I25 (= I31), D27 (= D33)
- binding alpha-D-glucopyranose: D58 (= D64), Y61 (= Y67), H101 (= H107), I141 (≠ A142), F161 (= F163), D197 (= D199), A198 (≠ V200), H201 (≠ C203), M227 (vs. gap), Q254 (≠ E254), Q254 (≠ E254), F280 (= F279), H320 (= H316), D321 (= D317), R405 (= R372)
Sites not aligning to the query:
4hphA The crystal structure of isomaltulose synthase mutant e295q from erwinia rhapontici nx5 in complex with its natural substrate sucrose (see paper)
38% identity, 93% coverage: 9:481/511 of query aligns to 6:525/559 of 4hphA
- active site: D99 (= D102), R198 (= R197), D200 (= D199), Q254 (≠ E254), H327 (= H316), D328 (= D317)
- binding calcium ion: D22 (= D25), N24 (= N27), D26 (= D29), I28 (= I31), D30 (= D33)
- binding beta-D-fructofuranose: F164 (= F163), Q254 (≠ E254), F256 (≠ N256), D328 (= D317), E387 (vs. gap), R415 (= R372)
- binding alpha-D-glucopyranose: D61 (= D64), Y64 (= Y67), H104 (= H107), F164 (= F163), D200 (= D199), Q254 (≠ E254), H327 (= H316), D328 (= D317), R415 (= R372)
4hozA The crystal structure of isomaltulose synthase mutant d241a from erwinia rhapontici nx5 in complex with d-glucose (see paper)
38% identity, 93% coverage: 9:481/511 of query aligns to 6:525/559 of 4hozA
- active site: D99 (= D102), R198 (= R197), A200 (≠ D199), E254 (= E254), H327 (= H316), D328 (= D317)
- binding calcium ion: D22 (= D25), N24 (= N27), D26 (= D29), I28 (= I31), D30 (= D33)
- binding alpha-D-glucopyranose: D61 (= D64), Y64 (= Y67), H104 (= H107), F164 (= F163), R198 (= R197), A200 (≠ D199), E254 (= E254), H327 (= H316), D328 (= D317), R415 (= R372)
4aieA Structure of glucan-1,6-alpha-glucosidase from lactobacillus acidophilus ncfm (see paper)
36% identity, 98% coverage: 9:509/511 of query aligns to 3:537/537 of 4aieA
4wlcA Structure of dextran glucosidase with glucose (see paper)
36% identity, 98% coverage: 9:509/511 of query aligns to 5:536/536 of 4wlcA
- active site: D98 (= D102), R192 (= R197), D194 (= D199), Q236 (≠ E254), H312 (= H316), D313 (= D317)
- binding beta-D-glucopyranose: D60 (= D64), Y63 (= Y67), H103 (= H107), F158 (= F163), D194 (= D199), H312 (= H316), D313 (= D317), R398 (= R372)
- binding calcium ion: D21 (= D25), N23 (= N27), D25 (= D29), I27 (= I31), D29 (= D33), D148 (≠ E153), D151 (≠ Q156)
2zidA Crystal structure of dextran glucosidase e236q complex with isomaltotriose (see paper)
36% identity, 98% coverage: 9:509/511 of query aligns to 5:536/536 of 2zidA
- active site: D98 (= D102), R192 (= R197), D194 (= D199), Q236 (≠ E254), H312 (= H316), D313 (= D317)
- binding calcium ion: D21 (= D25), N23 (= N27), D25 (= D29), I27 (= I31), D29 (= D33), D148 (≠ E153), D151 (≠ Q156)
- binding alpha-D-glucopyranose: D60 (= D64), Y63 (= Y67), H103 (= H107), F139 (≠ L143), F158 (= F163), D194 (= D199), V195 (= V200), Q236 (≠ E254), Q236 (≠ E254), W238 (≠ N256), K275 (vs. gap), H312 (= H316), D313 (= D317), E371 (vs. gap), R398 (= R372), R398 (= R372)
3gbeA Crystal structure of the isomaltulose synthase smua from protaminobacter rubrum in complex with the inhibitor deoxynojirimycin (see paper)
38% identity, 90% coverage: 9:469/511 of query aligns to 5:512/558 of 3gbeA
- active site: D98 (= D102), R197 (= R197), D199 (= D199), E253 (= E254), H326 (= H316), D327 (= D317)
- binding 1-deoxynojirimycin: D60 (= D64), Y63 (= Y67), H103 (= H107), F163 (= F163), R197 (= R197), D199 (= D199), H326 (= H316), D327 (= D317), R414 (= R372)
5brpA Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png (see paper)
37% identity, 90% coverage: 7:466/511 of query aligns to 1:504/555 of 5brpA
- active site: D96 (= D102), Q196 (≠ R197), D198 (= D199), E249 (= E254), H323 (= H316), D324 (= D317)
- binding magnesium ion: D19 (= D25), T21 (≠ N27), N23 (≠ D29), V25 (≠ I31), D27 (= D33)
- binding 4-nitrophenyl alpha-D-glucopyranoside: D58 (= D64), N59 (≠ A65), Y61 (= Y67), H101 (= H107), Y162 (≠ F163), D198 (= D199), V199 (= V200), E249 (= E254)
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
36% identity, 93% coverage: 8:481/511 of query aligns to 5:524/557 of 4h8vA
- active site: D99 (= D102), R198 (= R197), D200 (= D199), E254 (= E254), H326 (= H316), D327 (= D317)
- binding calcium ion: D22 (= D25), N24 (= N27), D26 (= D29), I28 (= I31), D30 (= D33)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D64), Y64 (= Y67), H104 (= H107), F164 (= F163), D200 (= D199), E254 (= E254), F256 (≠ N256), R284 (vs. gap), R291 (vs. gap), H326 (= H316), D327 (= D317), E386 (≠ D368), R414 (= R372)
Query Sequence
>GFF3716 FitnessBrowser__psRCH2:GFF3716
MSETTRTPWWKGATVYQIYPRSFADSNGDGIGDLNGVLRHLDHLQQLGVDALWLSPIFRS
PMADAGYDISDYCDIDPLFGSLADIDRLIAEAHARNIRVLLDFVPNHTSDEHPWFVESRS
SRDNPKRDWYIWRDQPNNWRAALGAGSAWTWDEHTQQYYLHLFLAKQPDLNWRNPEVVEA
MHDVLRFWLDRGIDGFRIDVIHCTGKDLSFADDPRCQAGQPLSDFNDQPYSHEVLRGLRK
LVDSYPGDRMLVGEVNIRSTERVLQYYGAGDELHLAFNFNPLDAPWDPVLFRTCIREVEH
WLQPAGAWPTWVLSNHDNVRQRSRYRGSERAARAAAVLLLTLRGTPFIYQGEELGLEDAH
IRDEARIDPGGRDGCRAPIPWQAEPPHGWQGAEPWLPFPPDAAELAAERQTGAANSIFAL
YQRLLAARKASPALHHGDFEELASHPEVLAYRRQHGDDCRLVCINFSEQPHAHPHAGDWH
VEIASDGVGENAPYNGTLNPGQAVVLRPMEN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory