SitesBLAST
Comparing GFF3718 FitnessBrowser__WCS417:GFF3718 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
33% identity, 95% coverage: 8:412/425 of query aligns to 12:421/425 of O59010
- S65 (≠ C63) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A273) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 273:275) binding
- M311 (≠ L308) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ A311) binding
- V355 (= V352) binding
- D394 (≠ E385) binding
- M395 (= M386) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (≠ T388) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N392) binding
- D405 (≠ N396) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
33% identity, 94% coverage: 8:407/425 of query aligns to 3:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
33% identity, 94% coverage: 8:408/425 of query aligns to 4:409/409 of 6bavA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
33% identity, 94% coverage: 8:408/425 of query aligns to 12:417/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ A44), F46 (≠ A44), P75 (≠ D73), L91 (≠ C90), F95 (≠ L94), L130 (= L134), I133 (= I137), I159 (≠ V163), Y167 (≠ R171), K196 (= K193), G200 (≠ M197), I207 (= I204), F210 (= F207), L250 (≠ V247), I262 (≠ M259), M269 (≠ L266), T334 (≠ S331), V335 (≠ L332), G336 (= G333), T340 (≠ L337), L343 (≠ V340), M399 (≠ A390)
- binding aspartic acid: S277 (= S274), S278 (= S275), T314 (≠ A311), G354 (= G351), A358 (≠ F355), G359 (≠ M356), D394 (≠ E385), R397 (≠ T388), T398 (= T389)
- binding sodium ion: Y89 (≠ F88), T92 (≠ I91), S93 (≠ T92), G306 (= G303), T308 (≠ S305), N310 (= N307), N310 (= N307), M311 (≠ L308), D312 (= D309), S349 (= S346), I350 (≠ K347), T352 (≠ A349), N401 (= N392), V402 (= V393), D405 (≠ N396)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
32% identity, 94% coverage: 8:407/425 of query aligns to 4:408/408 of 6bauA
- binding cysteine: S270 (= S275), M303 (≠ L308), T306 (≠ A311), A345 (= A350), G346 (= G351), V347 (= V352), G351 (≠ M356), D386 (≠ E385), C389 (≠ T388), T390 (= T389), N393 (= N392)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
32% identity, 94% coverage: 8:407/425 of query aligns to 9:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G67), V83 (≠ L85), I157 (≠ M164), Y164 (≠ R171), K193 (= K193), T305 (≠ S305), I306 (≠ F306), I347 (≠ K347)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I12), M199 (= M199), S275 (= S275), T311 (≠ A311), G356 (≠ M356), L384 (≠ A378), D391 (≠ E385), R394 (≠ T388)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
33% identity, 94% coverage: 8:407/425 of query aligns to 8:414/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
33% identity, 94% coverage: 8:407/425 of query aligns to 7:413/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K193), G195 (≠ M197), R282 (≠ K284)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A273), S272 (= S274), S273 (= S275), M307 (≠ L308), T310 (≠ A311), G353 (= G354), A354 (≠ F355), R394 (≠ T388), T395 (= T389)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
33% identity, 94% coverage: 8:407/425 of query aligns to 10:416/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
33% identity, 94% coverage: 8:407/425 of query aligns to 10:416/427 of 5e9sA
- binding aspartic acid: R274 (≠ A273), S275 (= S274), S276 (= S275), T313 (≠ A311), G353 (= G351), V354 (= V352), A357 (≠ F355), G358 (≠ M356), D394 (≠ E385), R397 (≠ T388), T398 (= T389)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K193), G198 (≠ M197), Y202 (= Y201)
- binding sodium ion: Y87 (≠ F88), T90 (≠ I91), S91 (≠ T92), S276 (= S275), G305 (= G303), A306 (≠ Y304), T307 (≠ S305), N309 (= N307), N309 (= N307), M310 (≠ L308), D311 (= D309), S348 (= S346), I349 (≠ K347), G350 (= G348), T351 (≠ A349), N401 (= N392), V402 (= V393), D405 (≠ N396)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
33% identity, 94% coverage: 8:407/425 of query aligns to 3:405/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A273), S265 (= S275), M299 (≠ L308), T302 (≠ A311), T340 (≠ A349), G342 (= G351), V343 (= V352), G347 (≠ M356), D383 (≠ E385), R386 (≠ T388), T387 (= T389), N390 (= N392)
- binding decyl-beta-d-maltopyranoside: H23 (≠ Q28), V212 (≠ L222), A216 (= A226)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
31% identity, 94% coverage: 8:407/425 of query aligns to 4:396/396 of 6bmiA
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
28% identity, 93% coverage: 5:398/425 of query aligns to 41:469/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
27% identity, 93% coverage: 19:412/425 of query aligns to 33:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ L77), G89 (= G78), G92 (= G81), A95 (≠ S84), V96 (≠ L85), Y99 (≠ F88), M163 (≠ V163), F167 (≠ L167), F293 (= F298), V297 (= V302)
- binding aspartic acid: S268 (= S274), S269 (= S275), T306 (≠ A311), G346 (= G351), I347 (≠ V352), A350 (≠ F355), G351 (≠ M356), D380 (≠ E385), R383 (≠ T388), T384 (= T389)
6x2zA Heaat3-ofs-asp (see paper)
27% identity, 86% coverage: 45:410/425 of query aligns to 41:413/419 of 6x2zA
- binding aspartic acid: S275 (≠ A273), S277 (= S275), T314 (≠ A311), G354 (= G351), V355 (= V352), D388 (≠ E385), R391 (≠ T388), T392 (= T389)
- binding sodium ion: Y83 (≠ F88), T86 (≠ I91), T87 (= T92), G306 (= G303), A307 (≠ Y304), T308 (≠ S305), I309 (≠ F306), N310 (= N307), N310 (= N307), M311 (≠ L308), M311 (≠ L308), D312 (= D309), S349 (= S346), I350 (≠ K347), G351 (= G348), A352 (= A349), N395 (= N392), D399 (≠ N396)
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
27% identity, 86% coverage: 45:410/425 of query aligns to 47:423/430 of 7nsgA
- binding (+)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: S287 (= S275), D398 (≠ E385), R401 (≠ T388), T402 (= T389), N405 (= N392)
- binding (-)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: P366 (= P353), D398 (≠ E385), R401 (≠ T388), T402 (= T389)
- binding cholesterol hemisuccinate: I258 (≠ V247), L419 (≠ W406)
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
27% identity, 86% coverage: 45:410/425 of query aligns to 47:423/430 of 6s3qA
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: S286 (= S274), S287 (= S275), T324 (≠ A311), A358 (≠ T345), G361 (= G348), V365 (= V352), A368 (≠ F355), T372 (≠ I359), D398 (≠ E385), R401 (≠ T388), T402 (= T389), N405 (= N392)
- binding cholesterol hemisuccinate: K80 (≠ R79), R84 (= R83)
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
27% identity, 86% coverage: 45:410/425 of query aligns to 43:426/433 of 8cv2A
- binding sodium ion: Y85 (≠ F88), T88 (≠ I91), T89 (= T92), G319 (= G303), A320 (≠ Y304), N323 (= N307), N323 (= N307), M324 (≠ L308), D325 (= D309), N408 (= N392), D412 (≠ N396)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
26% identity, 90% coverage: 15:397/425 of query aligns to 18:404/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S274), S281 (= S275), T318 (≠ A311), G363 (≠ M356), M367 (≠ L360), V385 (≠ A378), D388 (≠ Y381), R395 (≠ T388), T396 (= T389)
- binding dodecyl beta-D-glucopyranoside: V19 (≠ L16), I20 (≠ L17), W389 (≠ R382)
- binding cholesterol hemisuccinate: R80 (= R79), R84 (= R83), I95 (≠ L94), I252 (≠ V243)
Sites not aligning to the query:
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
27% identity, 86% coverage: 45:410/425 of query aligns to 43:408/416 of 8cuaA
Query Sequence
>GFF3718 FitnessBrowser__WCS417:GFF3718
MHTPRIALVWQIMIGLLAGIAIGALLHQLPESRPWLVDNLLQPAGDIFIKLMKMIVVPIV
FACMVVGIAGHGDGKSLGRIGARSLGYFFCITTLAIIVGLVLGNLLKPGAGTELSSLHAA
SITLPTSSGAGHSLGQIIVGIIPDNVISAMAQGSLLSVLFFAVMFGLGVARLPAERKDPV
IALLRGVSDAMFKVTSMIMAYSPIGVFGMIAVTVANFGFGSLLPLAKLIMVSYVSIAFFV
LVVLNLVARLCGINLFALMRHIKDELILAFSTASSASVMPQLMKKLETYGVSPSLVSFVV
PVGYSFNLDGASLFLGIGTLFVAQLYGIDLSLGDQALLVVTMVLTSKGAAGVPGFMFVIL
SATLASAGLPLEGIAFIAGVYRLMEMPTTALNVLGNALAPLVIAKWEGRDAKATHEPSAK
NVPSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory