SitesBLAST
Comparing GFF372 FitnessBrowser__psRCH2:GFF372 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
76% identity, 98% coverage: 8:459/463 of query aligns to 2:428/428 of 3p0wB
- active site: K189 (= K220), K191 (= K222), D219 (= D250), N221 (= N252), E244 (= E275), N273 (= N304), D297 (= D328), H323 (= H354), N325 (= N356)
- binding d-glucarate: H27 (= H33), Y134 (= Y167), K191 (= K222), D219 (= D250), N221 (= N252), N273 (= N304), H323 (= H354), N325 (= N356), H352 (= H383), R406 (= R437)
- binding magnesium ion: D219 (= D250), E244 (= E275), N273 (= N304)
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
75% identity, 98% coverage: 8:460/463 of query aligns to 2:425/425 of 3nxlC
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
63% identity, 100% coverage: 1:461/463 of query aligns to 1:446/446 of P0AES2
- M1 (= M1) modified: Initiator methionine, Removed
- Y150 (= Y167) mutation to F: Reduces activity 100-fold.
- K207 (= K222) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D250) binding
- E266 (= E281) binding
- N289 (= N304) binding
- H339 (= H354) active site, Proton acceptor; mutation to A: Loss of activity.; mutation to N: Reduces activity 10000-fold.; mutation to Q: Reduces activity 1000-fold.
- N341 (= N356) mutation to D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; mutation to L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- D366 (= D381) mutation D->A,N: Reduces activity over 100-fold.
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
63% identity, 98% coverage: 8:461/463 of query aligns to 3:442/442 of 1ec8A
- active site: K201 (= K220), K203 (= K222), D231 (= D250), N233 (= N252), E256 (= E275), N285 (= N304), M286 (= M305), D309 (= D328), H335 (= H354), N337 (= N356), I361 (= I380)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (= N28), H28 (= H33), T99 (≠ E121), Y146 (= Y167), K203 (= K222), D231 (= D250), N233 (= N252), N285 (= N304), H335 (= H354), S336 (= S355), N337 (= N356), H364 (= H383), R418 (= R437)
- binding magnesium ion: D231 (= D250), E256 (= E275), N285 (= N304)
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
63% identity, 98% coverage: 8:461/463 of query aligns to 5:444/444 of 1ecqA
- active site: K203 (= K220), K205 (= K222), D233 (= D250), N235 (= N252), E258 (= E275), N287 (= N304), M288 (= M305), D311 (= D328), H337 (= H354), N339 (= N356), I363 (= I380)
- binding 4-deoxyglucarate: N25 (= N28), H30 (= H33), T101 (≠ E121), Y148 (= Y167), F150 (= F169), K205 (= K222), D233 (= D250), N235 (= N252), N287 (= N304), H337 (= H354), S338 (= S355), N339 (= N356), H366 (= H383), R420 (= R437)
- binding magnesium ion: D233 (= D250), E258 (= E275), N287 (= N304)
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
63% identity, 98% coverage: 8:461/463 of query aligns to 5:444/444 of 1ec9D
- active site: K203 (= K220), K205 (= K222), D233 (= D250), N235 (= N252), E258 (= E275), N287 (= N304), M288 (= M305), D311 (= D328), H337 (= H354), N339 (= N356), I363 (= I380)
- binding magnesium ion: D233 (= D250), E258 (= E275), N287 (= N304)
- binding xylarohydroxamate: H30 (= H33), T101 (≠ E121), Y148 (= Y167), F150 (= F169), K205 (= K222), D233 (= D250), N235 (= N252), N287 (= N304), H337 (= H354), S338 (= S355), N339 (= N356), H366 (= H383), R420 (= R437)
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
63% identity, 98% coverage: 8:461/463 of query aligns to 4:443/443 of 1jctA
- active site: K202 (= K220), K204 (= K222), D232 (= D250), N234 (= N252), E257 (= E275), N286 (= N304), M287 (= M305), D310 (= D328), H336 (= H354), L338 (≠ N356), I362 (= I380)
- binding d-glucarate: N24 (= N28), H29 (= H33), T100 (≠ E121), Y147 (= Y167), F149 (= F169), K204 (= K222), D232 (= D250), N286 (= N304), S337 (= S355), R419 (= R437)
- binding magnesium ion: D232 (= D250), E257 (= E275), N286 (= N304)
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
55% identity, 98% coverage: 7:461/463 of query aligns to 1:426/426 of 3pfrA
- active site: K185 (= K220), K187 (= K222), D215 (= D250), N217 (= N252), E240 (= E275), N269 (= N304), D293 (= D328), H319 (= H354), N321 (= N356)
- binding d-glucarate: N22 (= N28), H27 (= H33), Y130 (= Y167), F132 (= F169), K187 (= K222), D215 (= D250), N217 (= N252), N269 (= N304), H319 (= H354), S320 (= S355), N321 (= N356), H348 (= H383)
- binding magnesium ion: D215 (= D250), E240 (= E275), N269 (= N304)
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
55% identity, 98% coverage: 7:461/463 of query aligns to 2:430/432 of 3n6hB
- active site: K189 (= K220), K191 (= K222), D219 (= D250), N221 (= N252), E244 (= E275), N273 (= N304), D297 (= D328), H323 (= H354), N325 (= N356)
- binding magnesium ion: D219 (= D250), E244 (= E275), N273 (= N304)
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
55% identity, 97% coverage: 9:459/463 of query aligns to 3:439/441 of 3nfuA
- active site: K201 (= K220), K203 (= K222), D231 (= D250), N233 (= N252), E256 (= E275), N285 (= N304), D309 (= D328), H335 (= H354), N337 (= N356)
- binding magnesium ion: D231 (= D250), N233 (= N252), E256 (= E275), D257 (= D276), N285 (= N304)
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
37% identity, 95% coverage: 11:450/463 of query aligns to 6:420/427 of 4it1D
- active site: S51 (≠ V56), D54 (≠ G59), A98 (= A113), Y150 (= Y167), K194 (= K220), K196 (= K222), D224 (= D250), N226 (= N252), Y247 (= Y273), E249 (= E275), T271 (= T303), N272 (= N304), M273 (= M305), D296 (= D328), H323 (= H354), S324 (= S355), N325 (= N356), C349 (≠ I380), D350 (= D381)
- binding magnesium ion: D224 (= D250), E249 (= E275), N272 (= N304)
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
34% identity, 95% coverage: 11:451/463 of query aligns to 4:414/420 of 3vc6A
- active site: D52 (≠ G59), H55 (vs. gap), Y146 (= Y167), K188 (= K220), K190 (= K222), D218 (= D250), N220 (= N252), E243 (= E275), N266 (= N304), M267 (= M305), D290 (= D328), H317 (= H354), S318 (= S355), N319 (= N356), H321 (= H358), C343 (≠ I380), D344 (= D381)
- binding magnesium ion: D218 (= D250), E243 (= E275), N266 (= N304)
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
32% identity, 97% coverage: 3:451/463 of query aligns to 5:421/427 of 3va8A
3dg6A Crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone (see paper)
26% identity, 63% coverage: 132:422/463 of query aligns to 101:360/366 of 3dg6A
- active site: M134 (= M164), K160 (= K220), K162 (= K222), D191 (= D250), N193 (= N252), E217 (= E275), D242 (≠ A296), E243 (≠ T297), S244 (≠ G298), K266 (≠ P325), G292 (= G352), N293 (≠ S353), Q294 (≠ H354), G319 (≠ A379), E320 (≠ I380), L321 (≠ D381)
- binding magnesium ion: D191 (= D250), E217 (= E275), D242 (≠ A296)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: M134 (= M164), K160 (= K220), K162 (= K222), D191 (= D250), N193 (= N252), D242 (≠ A296), K266 (≠ P325), N293 (≠ S353), Q294 (≠ H354), I295 (≠ S355)
Sites not aligning to the query:
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
27% identity, 63% coverage: 130:420/463 of query aligns to 98:368/378 of 4hpnA
- active site: T134 (≠ I171), K164 (= K220), K166 (= K222), D194 (= D250), N196 (= N252), E220 (= E275), G245 (≠ N304), E246 (≠ M305), T247 (≠ V306), Q267 (≠ L326), D269 (= D328), H296 (≠ L349), V297 (≠ T350), W298 (= W351), R320 (= R376), E329 (vs. gap), F330 (vs. gap), H334 (= H383)
- binding calcium ion: D194 (= D250), D209 (vs. gap), E220 (= E275), G237 (≠ A296), E246 (≠ M305)
Sites not aligning to the query:
3u4fA Crystal structure of a mandelate racemase (muconate lactonizing enzyme family protein) from roseovarius nubinhibens
27% identity, 63% coverage: 126:416/463 of query aligns to 83:355/371 of 3u4fA
- active site: S122 (≠ A183), K150 (= K220), R152 (≠ K222), D162 (≠ E230), D188 (= D250), N190 (= N252), F213 (≠ A274), E214 (= E275), D235 (≠ P300), G239 (vs. gap), E240 (vs. gap), Q261 (≠ D328), D263 (≠ H330), H290 (= H354), A292 (≠ N356), N293 (= N357), K313 (≠ R376), E316 (≠ A379), I319 (vs. gap), G321 (vs. gap)
- binding magnesium ion: D188 (= D250), E214 (= E275), S229 (≠ K294), L232 (≠ T297), E240 (vs. gap)
Sites not aligning to the query:
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
23% identity, 64% coverage: 126:422/463 of query aligns to 84:345/351 of 5olcC
- active site: K148 (= K220), K150 (= K222), D178 (= D250), N180 (= N252), E204 (= E275), G229 (≠ N304), E230 (≠ A307), D253 (≠ H330), H280 (vs. gap), E304 (≠ A379), E309 (≠ W386)
- binding magnesium ion: D178 (= D250), E204 (= E275), E230 (≠ A307)
2ps2A Crystal structure of putative mandelate racemase/muconate lactonizing enzyme from aspergillus oryzae
23% identity, 72% coverage: 97:429/463 of query aligns to 53:361/361 of 2ps2A
- active site: S132 (≠ Y167), Q156 (≠ A217), S157 (≠ D218), V158 (≠ F219), K159 (= K220), D187 (= D250), E213 (= E275), D236 (≠ N304), E237 (≠ M305), K260 (≠ A327), Q287 (≠ H354), E288 (≠ S355), T289 (≠ N356), C313 (≠ I385), I314 (≠ W386), L315 (≠ Q387)
- binding magnesium ion: D187 (= D250), E213 (= E275), D236 (≠ N304)
Sites not aligning to the query:
3i6eA Crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.
24% identity, 63% coverage: 132:422/463 of query aligns to 90:349/356 of 3i6eA
- active site: S124 (≠ Y167), K149 (= K220), K151 (= K222), D179 (= D250), Y180 (≠ P251), N181 (= N252), Q182 (≠ G253), E205 (= E275), D230 (≠ N304), E231 (≠ M305), S232 (≠ V306), K254 (≠ P325), Y279 (≠ H354), G281 (≠ N356), D282 (≠ N357), M283 (≠ H358), C307 (≠ I380), E308 (≠ D381), F309 (≠ T382)
- binding magnesium ion: D179 (= D250), E205 (= E275), D230 (≠ N304)
3t8qB Crystal structure of mandelate racemase/muconate lactonizing enzyme family protein from hoeflea phototrophica
27% identity, 49% coverage: 190:416/463 of query aligns to 117:352/369 of 3t8qB
- active site: S120 (≠ R193), K147 (= K220), R149 (≠ K222), D159 (≠ E230), D185 (= D250), N187 (= N252), E211 (= E275), G236 (vs. gap), E237 (vs. gap), D239 (≠ N304), Q258 (≠ L326), D260 (= D328), H287 (= H354), A288 (≠ S355), A289 (≠ N356), K310 (≠ R376), E313 (≠ A379)
- binding magnesium ion: D185 (= D250), E211 (= E275), E237 (vs. gap)
Query Sequence
>GFF372 FitnessBrowser__psRCH2:GFF372
MSQPFSATPHVKSMQVIPVAGHDSMLLNLCGAHAPYFTRNLVLLTDNAGNTGIGEVPGGE
GIRQALERCRALVIGQPIGLYNRTLNSLRSAIASNAAGTPQATRHEVTSEAEAAVLKQPH
EINLRLDNVITAVEAALLDLLGQHLDVPVAELLGSGQQRDAVPMLAYLFYIGDRQRTDLP
YLASTGEDWYHLRHQQALTPDAIARLAEAARARYGFADFKLKGGVMRGEEEMQAIAAIKA
RFPDARVTLDPNGAWSLDEAIALCKGQGHLLAYAEDPCGPENGYSGREIMAEFKRATGIP
TATNMVATDWRQMGHSLRLEAVDIPLADPHFWTMQGSVRLAQMCEQFGLTWGSHSNNHFD
VSLAMFTHAAAAAPGRITAIDTHWIWQEGQERLTREPLQIVDGQVRVPERPGLGIEPDMD
RIMAAHELYKKVASGSRDDAMAMRYLVPGWTYDPKKPSLGRNT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory