SitesBLAST
Comparing GFF3721 FitnessBrowser__WCS417:GFF3721 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
34% identity, 96% coverage: 8:410/420 of query aligns to 14:420/425 of O59010
- S65 (≠ T63) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A272) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 272:274) binding
- M311 (≠ L307) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ S310) binding
- V355 (= V351) binding
- D394 (= D384) binding
- M395 (= M385) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R387) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N391) binding
- D405 (≠ N395) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
34% identity, 95% coverage: 8:406/420 of query aligns to 5:407/407 of 2nwwA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
33% identity, 95% coverage: 8:406/420 of query aligns to 6:408/408 of 6bauA
- binding cysteine: S270 (= S274), M303 (≠ L307), T306 (≠ S310), A345 (= A349), G346 (= G350), V347 (= V351), G351 (≠ S355), D386 (= D384), C389 (≠ R387), T390 (= T388), N393 (= N391)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
33% identity, 95% coverage: 8:406/420 of query aligns to 6:408/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
33% identity, 95% coverage: 8:406/420 of query aligns to 11:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G67), V83 (≠ M85), I157 (≠ F163), Y164 (vs. gap), K193 (= K192), T305 (≠ S304), I306 (≠ F305), I347 (≠ K346)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I10), M199 (= M198), S275 (= S274), T311 (≠ S310), G356 (≠ S355), L384 (≠ I377), D391 (= D384), R394 (= R387)
Sites not aligning to the query:
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
33% identity, 95% coverage: 8:406/420 of query aligns to 14:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ V44), F46 (≠ V44), P75 (≠ N73), L91 (≠ T90), F95 (≠ V94), L130 (= L133), I133 (≠ F136), I159 (≠ L162), Y167 (vs. gap), K196 (= K192), G200 (≠ Y196), I207 (= I203), F210 (= F206), L250 (≠ G246), I262 (≠ G258), M269 (≠ I265), T334 (≠ S330), V335 (≠ F331), G336 (≠ T332), T340 (≠ L336), L343 (= L339), M399 (≠ A389)
- binding aspartic acid: S277 (= S273), S278 (= S274), T314 (≠ S310), G354 (= G350), A358 (= A354), G359 (≠ S355), D394 (= D384), R397 (= R387), T398 (= T388)
- binding sodium ion: Y89 (≠ F88), T92 (≠ A91), S93 (= S92), G306 (= G302), T308 (≠ S304), N310 (= N306), N310 (= N306), M311 (≠ L307), D312 (= D308), S349 (= S345), I350 (≠ K346), T352 (≠ M348), N401 (= N391), V402 (= V392), D405 (≠ N395)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
32% identity, 95% coverage: 8:406/420 of query aligns to 6:396/396 of 6bmiA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
32% identity, 96% coverage: 9:413/420 of query aligns to 6:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A272), S265 (= S274), M299 (≠ L307), T302 (≠ S310), T340 (≠ M348), G342 (= G350), V343 (= V351), G347 (≠ S355), D383 (= D384), R386 (= R387), T387 (= T388), N390 (= N391)
- binding decyl-beta-d-maltopyranoside: H23 (= H26), V212 (≠ L221), A216 (= A225)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
32% identity, 96% coverage: 9:413/420 of query aligns to 10:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K192), G195 (≠ Y196), R282 (≠ E283)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A272), S272 (= S273), S273 (= S274), M307 (≠ L307), T310 (≠ S310), G353 (≠ R353), A354 (= A354), R394 (= R387), T395 (= T388)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
32% identity, 96% coverage: 9:413/420 of query aligns to 11:421/425 of 6zgbA
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
32% identity, 96% coverage: 9:413/420 of query aligns to 13:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ A272), S275 (= S273), S276 (= S274), T313 (≠ S310), G353 (= G350), V354 (= V351), A357 (= A354), G358 (≠ S355), D394 (= D384), R397 (= R387), T398 (= T388)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K192), G198 (≠ Y196), Y202 (≠ F200)
- binding sodium ion: Y87 (≠ F88), T90 (≠ A91), S91 (= S92), S276 (= S274), G305 (= G302), A306 (≠ Y303), T307 (≠ S304), N309 (= N306), N309 (= N306), M310 (≠ L307), D311 (= D308), S348 (= S345), I349 (≠ K346), G350 (= G347), T351 (≠ M348), N401 (= N391), V402 (= V392), D405 (≠ N395)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
32% identity, 96% coverage: 9:413/420 of query aligns to 13:423/426 of 6xwnB
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
31% identity, 95% coverage: 17:413/420 of query aligns to 33:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V77), G89 (= G78), G92 (= G81), A95 (= A84), V96 (≠ M85), Y99 (≠ F88), M163 (≠ L162), F167 (= F166), F293 (= F297), V297 (≠ L301)
- binding aspartic acid: S268 (= S273), S269 (= S274), T306 (≠ S310), G346 (= G350), I347 (≠ V351), A350 (= A354), G351 (≠ S355), D380 (= D384), R383 (= R387), T384 (= T388)
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
29% identity, 94% coverage: 14:409/420 of query aligns to 58:501/543 of P56564
- N206 (= N152) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
29% identity, 94% coverage: 14:409/420 of query aligns to 58:501/542 of P43003
- S363 (≠ A272) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ ASS 272:274) binding
- T396 (≠ S304) binding
- T402 (≠ S310) binding
- IPQAG 443:447 (≠ VARAS 351:355) binding
- D476 (= D384) binding
- R477 (≠ M385) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N391) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
29% identity, 94% coverage: 17:412/420 of query aligns to 25:397/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I68), S80 (≠ V77), G81 (= G78), G84 (= G81), Y91 (≠ F88), M156 (≠ L162), F160 (= F166), F286 (= F297), V290 (≠ L301)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V60), I148 (= I154), S262 (= S274), S263 (≠ E275), A292 (≠ Y303), T293 (≠ S304), M296 (≠ L307), T299 (≠ S310), G329 (= G347), A336 (= A354), G337 (≠ S355), D366 (= D384), R369 (= R387), N373 (= N391)
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
27% identity, 94% coverage: 14:409/420 of query aligns to 15:426/433 of 8cv2A
- binding sodium ion: Y85 (≠ F88), T88 (≠ A91), T89 (≠ S92), G319 (= G302), A320 (≠ Y303), N323 (= N306), N323 (= N306), M324 (≠ L307), D325 (= D308), N408 (= N391), D412 (≠ N395)
6x2zA Heaat3-ofs-asp (see paper)
27% identity, 94% coverage: 14:409/420 of query aligns to 13:413/419 of 6x2zA
- binding aspartic acid: S275 (≠ A272), S277 (= S274), T314 (≠ S310), G354 (= G350), V355 (= V351), D388 (= D384), R391 (= R387), T392 (= T388)
- binding sodium ion: Y83 (≠ F88), T86 (≠ A91), T87 (≠ S92), G306 (= G302), A307 (≠ Y303), T308 (≠ S304), I309 (≠ F305), N310 (= N306), N310 (= N306), M311 (≠ L307), M311 (≠ L307), D312 (= D308), S349 (= S345), I350 (≠ K346), G351 (= G347), A352 (≠ M348), N395 (= N391), D399 (≠ N395)
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
27% identity, 94% coverage: 14:409/420 of query aligns to 12:405/406 of 8ctcA
- binding glutamic acid: S268 (= S273), S269 (= S274), M303 (≠ L307), T306 (≠ S310), G346 (= G350), A350 (= A354), D380 (= D384), R383 (= R387)
- binding sodium ion: Y82 (≠ F88), T85 (≠ A91), T86 (≠ S92), S269 (= S274), G298 (= G302), A299 (≠ Y303), T300 (≠ S304), N302 (= N306), N302 (= N306), M303 (≠ L307), D304 (= D308), S341 (= S345), I342 (≠ K346), G343 (= G347), A344 (≠ M348), N387 (= N391), D391 (≠ N395)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
27% identity, 94% coverage: 14:409/420 of query aligns to 15:408/416 of 8cuaA
Query Sequence
>GFF3721 FitnessBrowser__WCS417:GFF3721
MNKNKLPRRIAVGIALGVLVGWACHHYAGSEQAAKALAGYFSMVTDIFLRMIKMIIAPLV
FATLVGGIASMGNSRSVGRIGMRAMLWFVTASLVSLMLGMALVNLFQPGAGLNMQVVQHA
TAAVPVNTGDFSLKTFISHVFPRSIAEAMANNEILQIVVFSLFFGFALAGVKRAGYTRIT
DTVDELAKVMFKITDYVMAFAPIGVFAAIASAITTNGLGLLADYAKLIAEFYLGIALLWV
LLFAAGYLFLGRSVFTLGKLIREPILLAFSTASSESAYPKTMEALEKFGAPKRVSSFVLP
LGYSFNLDGSMMYQAFAIMFIAQAYNIDLSFTQQLLILLTLMITSKGMAGVARASVVVVA
ATLPMFNLPEAGLLLIIGIDQFLDMARTATNVVGNSIATAVVAKSEAEEEPAELPQGARA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory