SitesBLAST
Comparing GFF3724 FitnessBrowser__psRCH2:GFF3724 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
24% identity, 98% coverage: 1:425/432 of query aligns to 26:409/824 of Q8GAI3
- W66 (= W55) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ A56) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
25% identity, 94% coverage: 1:406/432 of query aligns to 1:358/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G7), G9 (= G9), I10 (≠ V10), D30 (= D30), N32 (vs. gap), H33 (≠ Q32), K36 (≠ V35), A37 (= A36), T38 (≠ S40), A40 (= A42), G41 (≠ N43), A42 (= A44), G43 (= G45), V44 (≠ Q46), Y174 (≠ Q222), A203 (≠ L253), W206 (≠ Y256), I210 (≠ M260), Y250 (≠ V300), G305 (= G354), R307 (= R356), G333 (= G381), A334 (≠ T382), S335 (≠ L383), G336 (= G384), L337 (≠ W385), T338 (= T386)
6j39A Crystal structure of cmis2 with inhibitor (see paper)
26% identity, 70% coverage: 104:407/432 of query aligns to 54:360/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (≠ T292), Y252 (vs. gap), Y267 (≠ A315), R308 (= R356), R334 (≠ T382), I335 (≠ L383)
- binding flavin-adenine dinucleotide: A174 (≠ E228), A203 (≠ L253), W206 (≠ Y256), I228 (≠ S277), Y252 (vs. gap), R308 (= R356), S333 (≠ G381), R334 (≠ T382), I335 (≠ L383), G336 (= G384), V337 (≠ W385), Q338 (≠ T386)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
26% identity, 70% coverage: 104:407/432 of query aligns to 54:360/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (≠ E228), A203 (≠ L253), W206 (≠ Y256), G226 (= G275), G306 (= G354), R308 (= R356), S333 (≠ G381), R334 (≠ T382), I335 (≠ L383), G336 (= G384), V337 (≠ W385), Q338 (≠ T386)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
23% identity, 69% coverage: 120:416/432 of query aligns to 78:370/377 of Q5L2C2
- V180 (≠ N223) binding
- R309 (= R356) binding
- 334:340 (vs. 380:386, 29% identical) binding
- R336 (≠ T382) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
23% identity, 69% coverage: 120:416/432 of query aligns to 77:368/368 of 4yshB
- active site: I262 (≠ V311), L283 (= L332), G305 (= G354), N335 (≠ L383), L338 (≠ T386)
- binding flavin-adenine dinucleotide: V178 (≠ N223), S206 (≠ L253), W209 (≠ Y256), R307 (= R356), H332 (= H380), R334 (≠ T382), N335 (≠ L383), G336 (= G384), I337 (≠ W385), L338 (≠ T386)
- binding glycine: G249 (≠ Y298), Y251 (≠ V300), Y251 (≠ V300), A264 (≠ G313), R307 (= R356), R334 (≠ T382), R334 (≠ T382)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
23% identity, 69% coverage: 120:416/432 of query aligns to 77:368/370 of 4yshA
- active site: I262 (≠ V311), L283 (= L332), G305 (= G354), N335 (≠ L383), L338 (≠ T386)
- binding flavin-adenine dinucleotide: V178 (≠ N223), S206 (≠ L253), G207 (= G254), W209 (≠ Y256), R307 (= R356), H332 (= H380), R334 (≠ T382), N335 (≠ L383), G336 (= G384), I337 (≠ W385)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
22% identity, 80% coverage: 88:432/432 of query aligns to 54:403/403 of 2gagB
- active site: A61 (≠ L93), T64 (≠ C96), T65 (= T97)
- binding flavin-adenine dinucleotide: G58 (vs. gap), N59 (≠ Q91), M60 (= M92), R62 (= R94), N63 (= N95), T64 (≠ C96), I66 (≠ A98), V195 (≠ I224), G224 (≠ L253), A225 (≠ G254), H227 (≠ Y256), L231 (≠ M260), L246 (= L273), G352 (= G381), T353 (= T382), G354 (≠ L383), G355 (= G384), F356 (≠ W385), K357 (≠ T386)
- binding flavin mononucleotide: A61 (≠ L93), R62 (= R94), H171 (≠ C200), V250 (≠ T279), E278 (≠ I309), R321 (≠ V350), W323 (= W352)
- binding 2-furoic acid: T64 (≠ C96), I66 (≠ A98), R68 (= R100), M263 (≠ L294), Y270 (≠ A301), K357 (≠ T386), V401 (≠ A430)
- binding sulfite ion: K170 (≠ D199), K276 (≠ Q307)
Sites not aligning to the query:
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
29% identity, 39% coverage: 246:415/432 of query aligns to 195:360/369 of O31616
- H244 (≠ Y298) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R356) binding
- 327:333 (vs. 380:386, 29% identical) binding
- R329 (≠ T382) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- 174 binding
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
29% identity, 39% coverage: 246:415/432 of query aligns to 195:360/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ V300), R302 (= R356), R329 (≠ T382)
- binding flavin-adenine dinucleotide: S202 (≠ L253), G203 (= G254), W205 (≠ Y256), F209 (≠ M260), G300 (= G354), R302 (= R356), H327 (= H380), R329 (≠ T382), N330 (≠ L383), G331 (= G384), I332 (≠ W385)
- binding phosphate ion: R254 (= R308)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49, 174
- binding phosphate ion: 89
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
29% identity, 39% coverage: 246:415/432 of query aligns to 195:360/364 of 3if9A
- binding flavin-adenine dinucleotide: S202 (≠ L253), G203 (= G254), W205 (≠ Y256), F209 (≠ M260), G300 (= G354), R302 (= R356), H327 (= H380), F328 (≠ G381), R329 (≠ T382), N330 (≠ L383), G331 (= G384), I332 (≠ W385)
- binding glycolic acid: Y246 (≠ V300), R302 (= R356), R329 (≠ T382)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49, 173, 174
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
22% identity, 80% coverage: 88:432/432 of query aligns to 56:405/405 of P40875
- C146 (≠ E176) mutation to S: No change in activity.
- H173 (≠ C200) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ M202) mutation to A: No effect on FMN binding and activity.
- C195 (≠ Q222) mutation to S: No change in activity.
- C351 (≠ T378) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
20% identity, 67% coverage: 122:411/432 of query aligns to 72:356/363 of 7cyxA
- binding flavin-adenine dinucleotide: V171 (≠ I224), G200 (≠ L253), G201 (= G254), W203 (≠ Y256), G298 (= G354), R300 (= R356), P301 (= P357), Y326 (≠ G381), R327 (≠ T382), N328 (≠ L383), G329 (= G384), I330 (≠ W385)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 30, 31, 32, 38, 39, 40, 43, 45, 46
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
22% identity, 80% coverage: 88:432/432 of query aligns to 56:405/405 of Q50LF2
- N61 (≠ Q91) binding
- M62 (= M92) binding
- T66 (≠ C96) binding
- I68 (≠ A98) binding
- K172 (≠ D199) mutation to A: Retains 39% of wild-type activity.; mutation to D: Retains 32% of wild-type activity.; mutation to R: Retains 58% of wild-type activity.
- H173 (≠ C200) modified: Tele-8alpha-FMN histidine
- V197 (≠ I224) binding
- H270 (≠ K299) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ A301) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G381) binding
- G357 (= G384) binding
- K359 (≠ T386) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
22% identity, 80% coverage: 88:432/432 of query aligns to 55:404/404 of 3ad8B
- active site: A62 (≠ L93), T65 (≠ C96), T66 (= T97), G326 (= G354), K358 (≠ T386)
- binding flavin-adenine dinucleotide: G59 (vs. gap), N60 (≠ Q91), M61 (= M92), R63 (= R94), N64 (= N95), T65 (≠ C96), I67 (≠ A98), V196 (≠ I224), G225 (≠ L253), A226 (≠ G254), H228 (≠ Y256), L247 (= L273), G353 (= G381), T354 (= T382), G355 (≠ L383), G356 (= G384), F357 (≠ W385), K358 (≠ T386)
- binding flavin mononucleotide: A62 (≠ L93), R63 (= R94), H172 (≠ C200), V251 (≠ T279), E279 (≠ I309), R322 (≠ V350), W324 (= W352)
- binding pyrrole-2-carboxylate: T65 (≠ C96), I67 (≠ A98), R69 (= R100), M264 (≠ L294), Y271 (≠ A301), T354 (= T382), K358 (≠ T386), V402 (≠ A430)
Sites not aligning to the query:
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
22% identity, 80% coverage: 88:432/432 of query aligns to 55:404/404 of 3ad7B
- active site: A62 (≠ L93), T65 (≠ C96), T66 (= T97), G326 (= G354), K358 (≠ T386)
- binding flavin-adenine dinucleotide: G59 (vs. gap), N60 (≠ Q91), M61 (= M92), R63 (= R94), N64 (= N95), T65 (≠ C96), I67 (≠ A98), V196 (≠ I224), G225 (≠ L253), A226 (≠ G254), H228 (≠ Y256), L247 (= L273), G353 (= G381), T354 (= T382), G355 (≠ L383), G356 (= G384), F357 (≠ W385), K358 (≠ T386)
- binding flavin mononucleotide: A62 (≠ L93), R63 (= R94), H172 (≠ C200), V251 (≠ T279), K277 (≠ Q307), E279 (≠ I309), R322 (≠ V350), W324 (= W352)
- binding [methylthio]acetate: I67 (≠ A98), R69 (= R100), M264 (≠ L294), Y271 (≠ A301), T354 (= T382), K358 (≠ T386), V402 (≠ A430)
Sites not aligning to the query:
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
26% identity, 39% coverage: 246:415/432 of query aligns to 195:360/369 of S5FMM4
- S202 (≠ L253) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ W385) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L395) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
22% identity, 74% coverage: 88:405/432 of query aligns to 55:377/402 of 1vrqB
- active site: A62 (≠ L93), T65 (≠ C96), T66 (= T97), G326 (= G354), K358 (≠ T386)
- binding n,n-dimethylglycine: T65 (≠ C96), I67 (≠ A98), R69 (= R100), K358 (≠ T386)
- binding flavin-adenine dinucleotide: G59 (vs. gap), N60 (≠ Q91), M61 (= M92), R63 (= R94), N64 (= N95), T65 (≠ C96), I67 (≠ A98), V196 (≠ I224), A224 (= A252), G225 (≠ L253), H228 (≠ Y256), L247 (= L273), G353 (= G381), T354 (= T382), G355 (≠ L383), G356 (= G384), F357 (≠ W385), K358 (≠ T386)
- binding flavin mononucleotide: A62 (≠ L93), R63 (= R94), H172 (≠ C200), V251 (≠ T279), E279 (≠ I309), R322 (≠ V350), W324 (= W352)
Sites not aligning to the query:
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
20% identity, 77% coverage: 85:416/432 of query aligns to 36:368/374 of 1y56B
- active site: F44 (≠ L93), G47 (≠ C96), T48 (= T97), H224 (≠ G275), P239 (= P289), G305 (= G354), M338 (≠ T386)
- binding flavin-adenine dinucleotide: S42 (≠ Q91), T43 (≠ M92), R45 (= R94), C46 (≠ N95), G47 (≠ C96), G49 (≠ A98), E170 (≠ N223), V171 (≠ I224), T200 (≠ L253), N201 (≠ G254), W203 (≠ Y256), G305 (= G354), Y306 (≠ L355), Y307 (≠ R356), G334 (≠ T382), H335 (≠ L383), G336 (= G384), F337 (≠ W385), M338 (≠ T386)
- binding flavin mononucleotide: F44 (≠ L93), R45 (= R94), I260 (≠ R310), R301 (≠ V350), W303 (= W352)
Sites not aligning to the query:
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
42% identity, 11% coverage: 3:50/432 of query aligns to 6:53/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G7), G12 (= G9), I14 (≠ V11), E33 (≠ D30), K34 (≠ R31), E41 (= E38), T42 (= T39), S43 (= S40), A45 (= A42), N46 (= N43), S47 (≠ A44), V49 (≠ Q46), H51 (≠ S48)
- binding sn-glycerol-3-phosphate: S47 (≠ A44), H51 (≠ S48)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 176, 177, 209, 210, 212, 234, 319, 320, 346, 347, 348, 349, 350, 351, 352
- binding sn-glycerol-3-phosphate: 258, 259, 320, 348
Query Sequence
>GFF3724 FitnessBrowser__psRCH2:GFF3724
MRVLVLGSGVVGTASAYYLARAGFEVVVVDRQPAVAMETSFANAGQVSPGYASPWAAPGV
PLKAMKWLLQRHAPLAIKLTGDVDQYLWMAQMLRNCTAARYAVNKERMVRLSEYSRDCLD
ELRAETGIAYEGRQLGTTQLFRTQAQLDAAAKDIAVLERSGVPYELLDRAAIGRVEPALA
KVAHKLSGALRLPNDQTGDCQMFTSRLAEMALALGVEFRFGQNIQRLEHAGDRIAGVWID
GKLETADRYVLALGSYSPQMLKPLGIRAPVYPLKGYSLTVPISDPAMAPQSTVLDETYKV
AITRFDQRIRVGGMAEIAGHDLSLNPRRRETLEMVVGDLYPQGGDPAEAVFWTGLRPATP
DGTPIIGATAYRNLYLNTGHGTLGWTMACGSGRVLADLLASKRPQISTDGLDIFRYGKHK
ETRKHAHPAAAH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory