SitesBLAST
Comparing GFF3726 FitnessBrowser__psRCH2:GFF3726 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
24% identity, 80% coverage: 43:399/444 of query aligns to 23:364/383 of 5i39A
- active site: F66 (≠ N86), Q69 (= Q89), A70 (≠ L90), Q248 (≠ L284), P267 (≠ D303)
- binding flavin-adenine dinucleotide: V30 (= V50), G31 (= G51), G33 (= G53), I34 (≠ F54), L35 (≠ S55), V53 (≠ L73), E54 (= E74), K55 (≠ A75), Q62 (≠ A82), S63 (= S83), F66 (≠ N86), Y67 (≠ G87), Q69 (= Q89), A196 (= A224), A197 (≠ V225), G226 (≠ C252), G227 (≠ N253), W229 (≠ Y255), Q248 (≠ L284), Q250 (≠ R286), G321 (= G355), M323 (≠ I357), T348 (≠ S383), G349 (= G384), W350 (≠ H385), G351 (= G386), M352 (≠ L387), T353 (≠ N388)
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
22% identity, 81% coverage: 43:402/444 of query aligns to 3:352/374 of 1y56B
- active site: F44 (≠ G84), G47 (= G87), T48 (≠ G88), H224 (≠ S272), P239 (≠ M293), G305 (= G355), M338 (≠ N388)
- binding flavin-adenine dinucleotide: G11 (= G51), G13 (= G53), I14 (≠ F54), V15 (≠ S55), I33 (≠ L73), E34 (= E74), K35 (≠ A75), S42 (≠ A82), T43 (≠ S83), R45 (= R85), C46 (≠ N86), G47 (= G87), G49 (≠ Q89), E170 (≠ A224), V171 (= V225), T200 (≠ C252), N201 (= N253), W203 (≠ Y255), G305 (= G355), Y306 (≠ M356), Y307 (≠ I357), G334 (= G384), H335 (= H385), G336 (= G386), F337 (≠ L387), M338 (≠ N388)
- binding flavin mononucleotide: F44 (≠ G84), R45 (= R85), I260 (≠ D310), R301 (≠ Y351), W303 (= W353)
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
26% identity, 48% coverage: 43:255/444 of query aligns to 15:221/433 of 5hxwA
- active site: F58 (≠ N86), Q61 (= Q89), A62 (≠ L90)
- binding flavin-adenine dinucleotide: V22 (= V50), G23 (= G51), G25 (= G53), I26 (≠ F54), L27 (≠ S55), E46 (= E74), K47 (≠ A75), E53 (≠ G81), Q54 (≠ A82), S55 (= S83), R57 (= R85), F58 (≠ N86), Y59 (≠ G87), G60 (= G88), Q61 (= Q89), A188 (= A224), A189 (≠ V225), G218 (≠ C252), G219 (≠ N253), W221 (≠ Y255)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
27% identity, 54% coverage: 27:267/444 of query aligns to 10:239/824 of Q8GAI3
- W66 (≠ G84) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ R85) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
25% identity, 82% coverage: 42:407/444 of query aligns to 17:376/403 of 2gagB
- active site: A61 (≠ I91), T64 (≠ V94), T65 (= T102)
- binding flavin-adenine dinucleotide: G26 (= G51), G28 (= G53), G29 (≠ F54), H30 (≠ S55), E51 (= E74), K52 (≠ A75), G58 (= G88), N59 (≠ Q89), M60 (≠ L90), R62 (= R92), N63 (≠ G93), T64 (≠ V94), I66 (≠ N103), V195 (= V225), G224 (≠ C252), A225 (≠ N253), H227 (≠ Y255), L231 (= L259), L246 (≠ I275), G352 (≠ S383), T353 (≠ G384), G354 (≠ H385), G355 (= G386), F356 (≠ L387), K357 (≠ N388)
- binding flavin mononucleotide: A61 (≠ I91), R62 (= R92), H171 (≠ P201), V250 (≠ T277), E278 (≠ R312), R321 (≠ Y351), W323 (= W353)
- binding 2-furoic acid: T64 (≠ V94), I66 (≠ N103), R68 (≠ L105), M263 (≠ P290), Y270 (= Y304), K357 (≠ N388)
- binding sulfite ion: K170 (≠ H200), K276 (≠ D310)
Sites not aligning to the query:
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
23% identity, 57% coverage: 153:405/444 of query aligns to 99:350/369 of O31616
- V174 (= V225) binding
- H244 (≠ N292) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ I357) binding
- 327:333 (vs. 382:388, 14% identical) binding
- R329 (≠ G384) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
23% identity, 57% coverage: 154:405/444 of query aligns to 100:350/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ A294), R302 (≠ I357), R329 (≠ G384)
- binding flavin-adenine dinucleotide: V174 (= V225), S202 (≠ C252), G203 (≠ N253), W205 (≠ Y255), F209 (vs. gap), G300 (= G355), R302 (≠ I357), H327 (≠ Y382), R329 (≠ G384), N330 (≠ H385), G331 (= G386), I332 (≠ L387)
- binding phosphate ion: R254 (= R312)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
23% identity, 57% coverage: 153:405/444 of query aligns to 99:350/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ A224), V174 (= V225), S202 (≠ C252), G203 (≠ N253), W205 (≠ Y255), F209 (vs. gap), G300 (= G355), R302 (≠ I357), H327 (≠ Y382), F328 (≠ S383), R329 (≠ G384), N330 (≠ H385), G331 (= G386), I332 (≠ L387)
- binding glycolic acid: Y246 (≠ A294), R302 (≠ I357), R329 (≠ G384)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
25% identity, 47% coverage: 203:410/444 of query aligns to 175:381/405 of P40875
- H175 (≠ N203) mutation to A: No effect on FMN binding and activity.
- C195 (≠ S223) mutation to S: No change in activity.
- C351 (≠ Q380) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
- 146 C→S: No change in activity.
- 173 modified: Tele-8alpha-FMN histidine; H→N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
Query Sequence
>GFF3726 FitnessBrowser__psRCH2:GFF3726
MQTFHDTSVNHRASASNTSDHAPSYYAASVNRELSFEPLQGEQRADVCIVGGGFSGLNTA
IELAERGLSVILLEAHRIGWGASGRNGGQLIRGVGHDVEQFTNILGEEGVDELKRMGFEA
VDIVRQRIERYAIDCDLTWGYCDLATKPRHLKGFDEEYSDLLRLGYPHPLQRVSRPNLAT
VVGSQRYLGGLLDMGSGHLHPLNLALGEAAAAQSLGVRLFEQSAVERIEYGPQVALHTAQ
GVVHADNLVLACNAYLNGLQPKLAGKVLPAGSYIIATERLPEPLQRELLPQNMAVCDQRV
ALDYFRLSADGRLLFGGACHYSGRDPKDIAAYMQPKMLEVFPQLIGIGIDYQWGGMIGIG
ANRLPQIGRLPEQPNVFYAQAYSGHGLNATHLAGHLLAEAIATQESHGFDLFAQVPHPTF
PGGRALRSPLLALGMLWYRLKDRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory