Comparing GFF373 FitnessBrowser__psRCH2:GFF373 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ur8A Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid (see paper)
52% identity, 98% coverage: 1:297/303 of query aligns to 1:296/304 of 4ur8A
5hwnB Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate (see paper)
52% identity, 98% coverage: 1:297/303 of query aligns to 1:296/310 of 5hwnB
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
28% identity, 75% coverage: 19:246/303 of query aligns to 10:238/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
28% identity, 75% coverage: 19:246/303 of query aligns to 10:238/296 of 7lvlA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
29% identity, 85% coverage: 37:293/303 of query aligns to 27:281/292 of Q07607
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
27% identity, 72% coverage: 19:235/303 of query aligns to 10:227/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
26% identity, 72% coverage: 19:235/303 of query aligns to 10:227/294 of 4i7wA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
29% identity, 83% coverage: 35:285/303 of query aligns to 26:273/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
29% identity, 83% coverage: 35:285/303 of query aligns to 26:273/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
29% identity, 83% coverage: 35:285/303 of query aligns to 26:273/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
29% identity, 83% coverage: 35:285/303 of query aligns to 26:273/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
29% identity, 83% coverage: 35:285/303 of query aligns to 26:273/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
29% identity, 83% coverage: 35:285/303 of query aligns to 26:273/291 of 3pueB
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
30% identity, 69% coverage: 19:226/303 of query aligns to 10:217/292 of 3s8hA
Sites not aligning to the query:
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
30% identity, 69% coverage: 19:226/303 of query aligns to 10:217/292 of 3puoA
Sites not aligning to the query:
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
29% identity, 95% coverage: 13:299/303 of query aligns to 5:289/291 of 3na8A
4pfmA Shewanella benthica dhdps with lysine and pyruvate
26% identity, 89% coverage: 19:288/303 of query aligns to 11:278/295 of 4pfmA
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
27% identity, 76% coverage: 19:248/303 of query aligns to 11:239/293 of 5t25A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
27% identity, 76% coverage: 19:248/303 of query aligns to 10:238/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
27% identity, 76% coverage: 19:248/303 of query aligns to 10:238/292 of P0A6L2
>GFF373 FitnessBrowser__psRCH2:GFF373
MNPQELKAILSSGLLSFPVTDFDAQGDFHRAGYIKRLEWLGPYGASALFAAGGTGEFFSL
EPREYSEIIKTAVDTCAGTVPILAGVGGPTRLAIQMAQEAERLGAKGLLLLPHYLTEASQ
EGVALHVEQVCKSVNIGVVVYNRNVCRLTAPHLEQLAERCPNLIGYKDGLGDIELMVSIR
RRLGERFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMDFYQAIAREDHETVGK
LIDDFFLPYLDIRNRCKGYAVSIVKAGARISGYDAGPVRAPLTELKPDEYERLAVLIEKQ
GAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory