SitesBLAST
Comparing GFF3746 FitnessBrowser__Phaeo:GFF3746 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
40% identity, 98% coverage: 16:985/988 of query aligns to 19:964/967 of Q46337
- G139 (= G181) mutation to A: Does not affect activity and binding of NAD(+).
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
40% identity, 98% coverage: 16:985/988 of query aligns to 17:962/965 of 2gagA
- active site: L350 (= L385), L375 (= L405), D677 (= D700)
- binding flavin mononucleotide: K510 (= K533), R511 (= R534), T517 (≠ M540), Q521 (= Q544), T549 (≠ I571), R551 (= R573)
- binding 2-furoic acid: N647 (= N670), G653 (= G676), T655 (≠ A678), K851 (= K874)
- binding nicotinamide-adenine-dinucleotide: V134 (≠ I178), G135 (= G179), G137 (= G181), P138 (= P182), A139 (≠ T183), D158 (≠ E202), E159 (= E203), R160 (≠ D204), G165 (= G209), T166 (≠ R210), T204 (= T247), V205 (= V248), T249 (= T291), G250 (= G292), S295 (≠ D337), F381 (≠ W411), G417 (= G448), A418 (= A449), L423 (≠ M454), D424 (≠ T455), T425 (= T456), Y554 (= Y576)
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
38% identity, 99% coverage: 12:985/988 of query aligns to 12:961/963 of 3ad7A
- active site: L349 (= L385), L374 (= L405), D676 (= D700)
- binding flavin mononucleotide: K509 (= K533), R510 (= R534), T516 (≠ M540), Q520 (= Q544), T548 (≠ I571), R550 (= R573)
- binding nicotinamide-adenine-dinucleotide: G134 (= G179), G136 (= G181), P137 (= P182), A138 (≠ T183), D157 (≠ E202), E158 (= E203), R159 (≠ D204), T165 (≠ R210), V204 (= V248), T248 (= T291), A249 (≠ G292), S294 (≠ D337), F380 (≠ W411), G416 (= G448), L422 (≠ M454), D423 (≠ T455), T424 (= T456)
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
38% identity, 99% coverage: 12:985/988 of query aligns to 12:961/963 of 1vrqA
- active site: L349 (= L385), L374 (= L405), D676 (= D700)
- binding flavin mononucleotide: K509 (= K533), R510 (= R534), T516 (≠ M540), Q520 (= Q544), T548 (≠ I571), R550 (= R573)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (= L655), Y663 (= Y687), G677 (= G701), H690 (≠ T714), I774 (= I799), F776 (= F801), E783 (= E808), K822 (= K847), F824 (≠ H849)
- binding nicotinamide-adenine-dinucleotide: G134 (= G179), G136 (= G181), P137 (= P182), A138 (≠ T183), D157 (≠ E202), E158 (= E203), R159 (≠ D204), T165 (≠ R210), V204 (= V248), T248 (= T291), A249 (≠ G292), S294 (≠ D337), F380 (≠ W411), G416 (= G448), L422 (≠ M454), D423 (≠ T455), T424 (= T456)
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
38% identity, 99% coverage: 12:985/988 of query aligns to 13:962/965 of Q50LF0
- A139 (≠ T183) binding
- D158 (≠ E202) binding
- E159 (= E203) binding
- R160 (≠ D204) binding
- T166 (≠ R210) binding
- V205 (= V248) binding
- A418 (= A449) binding
- L423 (≠ M454) binding
- T425 (= T456) binding
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
27% identity, 35% coverage: 618:960/988 of query aligns to 490:831/866 of Q9UI17
- A530 (≠ G648) to G: in dbSNP:rs1805073
- S646 (≠ D768) to P: in dbSNP:rs1805074
Sites not aligning to the query:
- 59:60 binding
- 80:81 binding
- 87:95 binding
- 91 modified: Tele-8alpha-FAD histidine
- 109 H → R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- 219 binding
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 35% coverage: 618:960/988 of query aligns to 483:824/857 of Q63342
Sites not aligning to the query:
- 52:53 binding
- 73:74 binding
- 80:88 binding
- 84 modified: Tele-8alpha-FAD histidine
- 212 binding
- 244 binding
- 390:395 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
27% identity, 35% coverage: 618:960/988 of query aligns to 446:787/824 of 4pabB
- active site: E536 (≠ D700)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ Y687), E536 (≠ D700), T538 (= T702), I550 (≠ T714), F612 (= F780), L613 (≠ M781), Y632 (≠ F801), E639 (= E808), F680 (≠ H849), Y700 (≠ R868)
Sites not aligning to the query:
- active site: 53, 102, 226, 255
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 35, 36, 37, 43, 44, 45, 47, 48, 49, 50, 51, 175, 204, 205, 207, 226, 228, 326, 328, 353, 355, 356, 357, 358
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
25% identity, 37% coverage: 599:963/988 of query aligns to 4:341/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
25% identity, 37% coverage: 599:963/988 of query aligns to 4:341/362 of 1wopA
- active site: D96 (= D700)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ L655), L55 (≠ D659), Y83 (= Y687), D96 (= D700), V98 (≠ T702), E106 (≠ H710), L108 (≠ V712), V110 (≠ T714), N112 (≠ T716), I137 (≠ T745), E160 (≠ D768), Y168 (≠ N775), Y169 (≠ E776), K173 (≠ V786), S174 (≠ T787), I175 (≠ V788), E180 (≠ R793), T181 (≠ A794), Y188 (≠ F801), E195 (= E808), M197 (≠ A810), R227 (≠ L840), Y236 (≠ H849)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
25% identity, 37% coverage: 599:963/988 of query aligns to 4:341/362 of 1wooA
- active site: D96 (= D700)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ L655), Y83 (= Y687), D96 (= D700), V98 (≠ T702), V110 (≠ T714), N112 (≠ T716), Y168 (≠ N775), Y169 (≠ E776), Y188 (≠ F801), E195 (= E808), Y236 (≠ H849)
Sites not aligning to the query:
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
27% identity, 36% coverage: 597:949/988 of query aligns to 429:792/828 of 1pj6A
Sites not aligning to the query:
- active site: 223, 257
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 172, 201, 202, 204, 223, 257, 331, 332, 358, 359, 360, 361
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
27% identity, 36% coverage: 597:949/988 of query aligns to 431:794/830 of Q9AGP8
- Y539 (= Y687) binding
- D552 (= D700) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 174 binding
- 225 Important for catalytic activity; H→Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
27% identity, 36% coverage: 597:949/988 of query aligns to 428:791/827 of 1pj7A
- active site: D549 (= D700)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (= L655), Y536 (= Y687), D549 (= D700), T551 (= T702), G563 (≠ T714), F629 (≠ M781), Y648 (≠ F801), E655 (= E808), Y696 (≠ H849)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 331, 357, 358, 359, 360
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
27% identity, 36% coverage: 597:949/988 of query aligns to 428:791/827 of 3gsiA
- active site: A549 (≠ D700)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (= L655), Y536 (= Y687), T551 (= T702), G563 (≠ T714), F629 (≠ M781), Y648 (≠ F801), E655 (= E808), Y696 (≠ H849)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
26% identity, 40% coverage: 596:987/988 of query aligns to 437:823/824 of Q8GAI3
Sites not aligning to the query:
- 66 mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- 67 H→A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
27% identity, 39% coverage: 599:979/988 of query aligns to 4:356/363 of 3a8iA
- active site: D97 (= D700)
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: M51 (≠ L655), Y84 (= Y687), D97 (= D700), I99 (≠ T702), V111 (≠ T714), N113 (≠ T716), F173 (= F780), Y188 (≠ F801), E195 (= E808), R223 (≠ L840), M232 (vs. gap), W252 (≠ R868)
1y56A Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
24% identity, 35% coverage: 239:585/988 of query aligns to 166:483/484 of 1y56A
- binding adenosine-5'-triphosphate: A175 (≠ V248), T207 (= T291), G208 (= G292), R303 (≠ W411), G342 (= G448), S343 (≠ A449), H350 (≠ T456), N353 (≠ A459)
- binding fe (iii) ion: G439 (≠ A541), C441 (≠ D543)
- binding flavin mononucleotide: R432 (= R534), M438 (= M540), R471 (= R573)
Sites not aligning to the query:
3tfjA Dmsp-dependent demethylase from p. Ubique - with cofactor thf (see paper)
23% identity, 32% coverage: 635:948/988 of query aligns to 43:340/369 of 3tfjA
- active site: D108 (= D700)
- binding (6s)-5,6,7,8-tetrahydrofolate: E63 (≠ L655), Y95 (= Y687), D108 (= D700), V110 (≠ T702), S122 (≠ T714), I123 (≠ T715), A124 (≠ T716), F178 (≠ M781), W197 (≠ F801), E204 (= E808), Y265 (≠ M869)
Sites not aligning to the query:
3tfiA Dmsp-dependent demethylase from p. Ubique - with substrate dmsp (see paper)
23% identity, 32% coverage: 635:948/988 of query aligns to 43:340/369 of 3tfiA
Sites not aligning to the query:
Query Sequence
>GFF3746 FitnessBrowser__Phaeo:GFF3746
MSRRSVLKNRLSGGLIDHDAPLSFQFDGKTYEGHQGDTLASALLANGVQLMGRSFKYHRP
RGVLTAGSEEPNALVELRSGGRQEPNTRATVVELFAGLEARSQNRWPSLDHDMMAINDRF
SNFLTAGFYYKTFMWPKAFWEKLYEPIIRKAAGLGSLTGEADPDAYDKGYLHCDLLIIGA
GPTGLAAALTAGRAGAQVILAEEDYRLGGRLLSETKALSEMSGTDWVAQTQAELAALPNV
RVMPRTTVFGAYDHGIYGAVERNADHVPTPTAGKPRQTLWRIYSKRALIATGAIERPIAF
ENNDRPGVMLAGAARAYANRWAATPGQSVVIFANGDDAYHTARDLMAKGVEVPAIVDVRD
GAPTLPGTEVLAGAEIIDTKGRLGLSSVTVRLANGQTRTIACDALAVSGGWNPNLGLTCH
QRGRPVWSDAIQSFVPGTGLPAGQLVAGAAMGGMTTAQALKGGAERAVEALGDLGISARA
ADLPQAEDAPVSLTPFWHVKGAKRAWLDFQNDVTVKDVKLAHQENFTSVEHLKRYTTLGM
ATDQGKTSNLGALAAMAELTGKSIPDTGTTIFRPPYTPVAMGALAGRAVGKDFHPTRLTP
SHKWAEEQGAVFVEVGNWLRAQWFPREGETHWRQSVDREVLQTRNSVGICDVTTLGKIDV
QGADAATFLNMVYANGFAKLPVGKVRYGLMLREDGVAYDDGTAARLAEDHFVVTTTTANA
VLVYRNMEFVRQCLCPDLDVQLISTTEAWAQYAVAGPNARKLLQKIVDPEFDISNEAFPF
MGCGEVTVCGGCRARLFRISFSGELAYEIAVPTRYGDALMREMMAAGEEFDVTPYGTEAL
GVMRIEKGHAAGNELNGTTSALNLGLGRMVSTKKDCIGNVLSRRDGMNKENALNLVGVRP
VKSSDGVPAGGHLMATDGPVDAAHDQGYVTSAAYSPILQSAIGLAFVKGGANRMGERLRL
VNPLQNQTVLVEIVSPHFVDPEGEKLRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory