SitesBLAST
Comparing GFF3765 FitnessBrowser__psRCH2:GFF3765 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
71% identity, 96% coverage: 3:382/394 of query aligns to 5:384/384 of Q9HTK9
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
71% identity, 96% coverage: 3:382/394 of query aligns to 2:381/381 of 2v3aA
- active site: L11 (= L12), K42 (= K43), P43 (= P44), M290 (= M291)
- binding flavin-adenine dinucleotide: I7 (= I8), G8 (= G9), T9 (= T10), G10 (= G11), A12 (= A13), T33 (= T34), A34 (= A35), D35 (= D36), K42 (= K43), P43 (= P44), R79 (= R80), V80 (= V81), A105 (= A106), W106 (= W107), G107 (= G108), I153 (= I154), F157 (= F158), D274 (= D275), L284 (= L285), Y285 (= Y286), V286 (= V287), K317 (= K318)
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
30% identity, 76% coverage: 5:304/394 of query aligns to 4:310/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G9), G10 (= G11), H11 (≠ L12), A12 (= A13), D34 (≠ A35), E35 (≠ D36), R42 (≠ K43), P43 (= P44), S46 (= S47), K47 (≠ T48), R78 (= R80), M79 (≠ V81), T106 (≠ W107), R127 (≠ N128), I153 (= I154), D275 (= D275), S292 (≠ A292), V293 (vs. gap)
Sites not aligning to the query:
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
31% identity, 70% coverage: 1:275/394 of query aligns to 3:270/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G11), A15 (= A13), D37 (≠ A35), E38 (≠ D36), R45 (≠ K43), P46 (= P44), K50 (≠ T48), A79 (≠ V81), T106 (≠ W107), G107 (= G108), R127 (≠ N128), I153 (= I154), G269 (= G274), D270 (= D275)
Sites not aligning to the query:
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
31% identity, 70% coverage: 1:275/394 of query aligns to 2:269/401 of 1f3pA
- active site: L13 (= L12), R44 (≠ K43), P45 (= P44)
- binding flavin-adenine dinucleotide: A14 (= A13), V34 (≠ I33), D36 (≠ A35), E37 (≠ D36), R44 (≠ K43), P45 (= P44), A78 (≠ V81), T105 (≠ W107), G106 (= G108), R126 (≠ N128), G268 (= G274), D269 (= D275)
- binding nicotinamide-adenine-dinucleotide: V147 (≠ L149), G148 (= G150), G150 (= G152), V151 (≠ L153), I152 (= I154), E155 (= E157), E171 (≠ A173), T172 (≠ P174), R179 (≠ G181), G230 (≠ A236), I231 (≠ V237), G232 (= G238), V233 (≠ L239)
Sites not aligning to the query:
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
31% identity, 70% coverage: 1:275/394 of query aligns to 2:269/402 of 2yvjA
- active site: L13 (= L12), R44 (≠ K43), P45 (= P44)
- binding flavin-adenine dinucleotide: G10 (= G9), G12 (= G11), G35 (≠ T34), D36 (≠ A35), E37 (≠ D36), R44 (≠ K43), P45 (= P44), A78 (≠ V81), T105 (≠ W107), G106 (= G108), R126 (≠ N128), G268 (= G274), D269 (= D275)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (≠ L149), G148 (= G150), G149 (≠ A151), G150 (= G152), I152 (= I154), V170 (= V172), E171 (≠ A173), T172 (≠ P174), R179 (≠ G181), G230 (≠ A236), I231 (≠ V237), G232 (= G238), V233 (≠ L239)
Sites not aligning to the query:
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
31% identity, 70% coverage: 1:275/394 of query aligns to 1:268/401 of 2gr2A
- active site: L12 (= L12), R43 (≠ K43), P44 (= P44)
- binding adenosine-5-diphosphoribose: R109 (≠ I112), V146 (≠ L149), G147 (= G150), G149 (= G152), V150 (≠ L153), I151 (= I154), E170 (≠ A173), T171 (≠ P174), R178 (≠ G181), G229 (≠ A236), I230 (≠ V237), G231 (= G238)
- binding flavin-adenine dinucleotide: G11 (= G11), A13 (= A13), D35 (≠ A35), E36 (≠ D36), R43 (≠ K43), P44 (= P44), K48 (≠ T48), A77 (≠ V81), T104 (≠ W107), G105 (= G108), R125 (≠ N128), G267 (= G274), D268 (= D275)
Sites not aligning to the query:
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
31% identity, 70% coverage: 1:275/394 of query aligns to 1:268/401 of 2gr0A
- active site: L12 (= L12), R43 (≠ K43), P44 (= P44)
- binding adenosine-5'-diphosphate: V146 (≠ L149), G147 (= G150), G149 (= G152), I151 (= I154), E170 (≠ A173), T171 (≠ P174), R178 (≠ G181), G229 (≠ A236), I230 (≠ V237), G231 (= G238)
- binding flavin-adenine dinucleotide: G11 (= G11), A13 (= A13), D35 (≠ A35), E36 (≠ D36), R43 (≠ K43), P44 (= P44), K48 (≠ T48), T76 (≠ R80), A77 (≠ V81), T104 (≠ W107), G105 (= G108), R125 (≠ N128), I151 (= I154), G267 (= G274), D268 (= D275)
Sites not aligning to the query:
4h4wA Crystal structure of ferredoxin reductase, bpha4 e175c/t176r/q177g mutant (reduced form)
31% identity, 70% coverage: 1:275/394 of query aligns to 1:268/399 of 4h4wA
- active site: L12 (= L12), R43 (≠ K43), P44 (= P44)
- binding flavin-adenine dinucleotide: G11 (= G11), A13 (= A13), D35 (≠ A35), R43 (≠ K43), P44 (= P44), A77 (≠ V81), T104 (≠ W107), G105 (= G108), R125 (≠ N128), I151 (= I154), E154 (= E157), G267 (= G274), D268 (= D275)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G148 (≠ A151), I151 (= I154), R171 (≠ P174), S177 (≠ P180), R178 (≠ G181), G229 (≠ A236), I230 (≠ V237), G231 (= G238)
Sites not aligning to the query:
4h4uA Crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form)
31% identity, 70% coverage: 1:275/394 of query aligns to 2:269/401 of 4h4uA
- active site: L13 (= L12), R44 (≠ K43), P45 (= P44)
- binding flavin-adenine dinucleotide: G12 (= G11), A14 (= A13), D36 (≠ A35), R44 (≠ K43), P45 (= P44), A78 (≠ V81), T105 (≠ W107), G106 (= G108), L125 (≠ I127), R126 (≠ N128), I152 (= I154), E155 (= E157), G268 (= G274), D269 (= D275)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V151 (≠ L153), I152 (= I154), E171 (≠ A173), R172 (≠ P174), Q173 (≠ S175), G230 (≠ A236), I231 (≠ V237), G232 (= G238)
Sites not aligning to the query:
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
27% identity, 89% coverage: 3:352/394 of query aligns to 1:332/346 of 1xhcA
- active site: P10 (≠ L12), K38 (= K43), P39 (= P44), F145 (≠ L153), E149 (= E157), M276 (= M291)
- binding flavin-adenine dinucleotide: V6 (≠ I8), G7 (= G9), G9 (= G11), P10 (≠ L12), G11 (≠ A13), D29 (≠ T34), K30 (≠ A35), K38 (= K43), P39 (= P44), E74 (≠ R80), A75 (≠ V81), A100 (= A106), T101 (≠ W107), G102 (= G108), L119 (≠ I127), R120 (≠ N128), F145 (≠ L153), I146 (= I154), E149 (= E157), G259 (= G274), D260 (= D275), G270 (≠ L285), T271 (≠ Y286), A272 (≠ V287)
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
26% identity, 95% coverage: 4:377/394 of query aligns to 2:354/359 of Q8U1K9
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
30% identity, 69% coverage: 5:276/394 of query aligns to 3:280/539 of 8a56B
- binding flavin-adenine dinucleotide: I6 (= I8), G7 (= G9), V9 (≠ G11), G11 (≠ A13), E32 (≠ T34), K33 (≠ A35), C42 (vs. gap), V80 (= V81), S109 (≠ A106), P110 (≠ W107), G111 (= G108), I159 (= I154), G278 (= G274), D279 (= D275)
- binding 3'-phosphate-adenosine-5'-diphosphate: T17 (≠ R19), R18 (≠ E20), R21 (≠ K23), F70 (≠ L71)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 295, 296, 297, 422, 423
- binding 3'-phosphate-adenosine-5'-diphosphate: 305, 356, 430, 435, 438, 505, 506, 509
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
31% identity, 69% coverage: 5:277/394 of query aligns to 6:285/422 of 1q1wA
- active site: L13 (= L12), L44 (≠ K43), P45 (= P44)
- binding flavin-adenine dinucleotide: G10 (= G9), G12 (= G11), L13 (= L12), A14 (= A13), G35 (≠ T34), D36 (≠ A35), L44 (≠ K43), P45 (= P44), K49 (≠ T48), V82 (= V81), A108 (= A106), T109 (≠ W107), G110 (= G108), R133 (≠ N128), I159 (= I154), D283 (= D275)
Sites not aligning to the query:
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
31% identity, 69% coverage: 5:277/394 of query aligns to 7:286/422 of P16640
- A15 (= A13) binding
- D37 (≠ A35) binding
- K50 (≠ T48) binding
- V83 (= V81) binding
- R134 (≠ N128) binding
- D284 (= D275) binding
Sites not aligning to the query:
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
29% identity, 56% coverage: 57:278/394 of query aligns to 56:290/541 of 6pfzA
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding calcium ion: 306, 332, 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 313, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42, 303, 304, 305
6tukB Crystal structure of fdr9 (see paper)
27% identity, 80% coverage: 5:320/394 of query aligns to 4:309/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (≠ I8), G8 (= G9), G9 (≠ T10), G10 (= G11), A12 (= A13), A34 (= A35), E35 (≠ D36), R42 (≠ K43), P43 (= P44), K47 (≠ T48), A75 (≠ R80), A76 (≠ V81), T102 (≠ W107), G103 (= G108), V118 (≠ I127), R119 (≠ N128), G259 (= G274), D260 (= D275), H277 (≠ Y286), W278 (≠ V287)
Sites not aligning to the query:
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
29% identity, 70% coverage: 6:282/394 of query aligns to 4:283/424 of 8c0zE
3icsB Crystal structure of partially reduced bacillus anthracis coadr-rhd (see paper)
26% identity, 66% coverage: 21:282/394 of query aligns to 21:291/554 of 3icsB
- active site: I39 (≠ R39), N43 (≠ K43), C44 (vs. gap)
- binding adenosine-5'-diphosphate: G162 (= G152), I164 (= I154), E183 (≠ A173), M184 (≠ P174), P190 (= P180), I244 (≠ V237), G245 (= G238)
- binding coenzyme a: R23 (≠ K23), S40 (= S40), N43 (≠ K43), C44 (vs. gap)
- binding flavin-adenine dinucleotide: E34 (≠ T34), R35 (≠ A35), N43 (≠ K43), C44 (vs. gap), V82 (= V81), S113 (≠ A106), P114 (≠ W107), G115 (= G108), L135 (≠ I127), R136 (≠ N128), I164 (= I154), L252 (= L245), G283 (= G274), D284 (= D275)
Sites not aligning to the query:
- active site: 12, 306, 427, 453, 454
- binding coenzyme a: 12, 15, 16, 19, 20, 306, 310, 428, 436, 441, 444, 445, 448, 517, 518, 521
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 300, 301, 302, 305
3ictA Crystal structure of reduced bacillus anthracis coadr-rhd (see paper)
26% identity, 66% coverage: 21:282/394 of query aligns to 24:294/557 of 3ictA
- active site: I42 (≠ R39), N46 (≠ K43), C47 (vs. gap)
- binding coenzyme a: R26 (≠ K23), S43 (= S40), N46 (≠ K43), C47 (vs. gap)
- binding flavin-adenine dinucleotide: E37 (≠ T34), R38 (≠ A35), N46 (≠ K43), C47 (vs. gap), V85 (= V81), S116 (≠ A106), P117 (≠ W107), G118 (= G108), L138 (≠ I127), G286 (= G274), D287 (= D275)
Sites not aligning to the query:
- active site: 15, 309, 430, 456, 457
- binding coenzyme a: 15, 18, 22, 23, 309, 313, 439, 451, 520, 521, 524
- binding flavin-adenine dinucleotide: 12, 14, 16, 303, 304, 305
Query Sequence
>GFF3765 FitnessBrowser__psRCH2:GFF3765
MSAPVVIIGTGLAGYNLAREFRKLDTQTPLLLITADDGRSYSKPLLSTGFAANKNAENLG
MATAGAMAEQLNAEIRIHTRVTRLDPANRRVWIGNEPVPYRDLVLAWGAQTIQVPVAGDA
ADAVFPINDLHDYGRFRDAVAGKRRVLILGAGLIGCEFANDLLLGGHEVDLVAPSEQVMP
GLLPLQAAEAVRNGLEGIGARFHLGATLERLQRSTDGLQATLSDGSQRSCDLVVSAVGLR
PRTELAAEAGLEVKRGIVVDRLLQTSAEHVYAVGDCAEVEGLNLLYVMPLMAGARALAKT
LFGNPTFVSYGPMPVTVKTPACPVVVSLPAVGSAGNWTVEAQGNDVKALYLGTSGQLLGY
ALTGAAVQERLALNKQLPPVLAELPQILSLKSPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory