SitesBLAST
Comparing GFF377 FitnessBrowser__psRCH2:GFF377 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
47% identity, 99% coverage: 4:309/309 of query aligns to 6:312/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
47% identity, 99% coverage: 4:309/309 of query aligns to 4:310/311 of 3bazA
- active site: L98 (= L97), R230 (= R229), A251 (= A250), D254 (= D253), E259 (= E258), H277 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V73), G149 (= G148), L150 (= L149), G151 (= G150), R152 (= R151), I153 (= I152), S172 (≠ N171), R173 (= R172), S174 (≠ R173), C201 (= C200), P202 (≠ V201), T207 (= T206), I228 (≠ V227), G229 (≠ A228), R230 (= R229), D254 (= D253), H277 (= H276), G279 (= G278)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
42% identity, 97% coverage: 10:309/309 of query aligns to 11:309/319 of 5v7nA
- active site: L95 (= L97), R229 (= R229), D253 (= D253), E258 (= E258), H276 (= H276)
- binding 2-keto-D-gluconic acid: G70 (= G72), V71 (= V73), G72 (= G74), R229 (= R229), H276 (= H276), S279 (= S279), R285 (= R285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (= V73), V99 (= V101), L149 (= L149), G150 (= G150), R151 (= R151), I152 (= I152), T171 (≠ N171), R172 (= R172), V200 (≠ C200), P201 (≠ V201), S205 (≠ Q205), T206 (= T206), V227 (= V227), G228 (≠ A228), R229 (= R229), H276 (= H276), A278 (≠ G278)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
42% identity, 97% coverage: 10:309/309 of query aligns to 12:310/319 of 5v6qB
- active site: L96 (= L97), R230 (= R229), D254 (= D253), E259 (= E258), H277 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V73), V100 (= V101), F148 (≠ L147), L150 (= L149), G151 (= G150), R152 (= R151), I153 (= I152), T172 (≠ N171), R173 (= R172), V201 (≠ C200), P202 (≠ V201), S206 (≠ Q205), T207 (= T206), V228 (= V227), G229 (≠ A228), R230 (= R229), H277 (= H276), A279 (≠ G278)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
42% identity, 97% coverage: 10:309/309 of query aligns to 10:308/318 of 5j23A
- active site: L94 (= L97), R228 (= R229), D252 (= D253), E257 (= E258), H275 (= H276)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (= V73), L148 (= L149), G149 (= G150), R150 (= R151), I151 (= I152), T170 (≠ N171), R171 (= R172), P200 (≠ V201), S204 (≠ Q205), T205 (= T206), R228 (= R229)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
42% identity, 97% coverage: 10:309/309 of query aligns to 10:308/317 of 5v7gA
- active site: L94 (= L97), R228 (= R229), D252 (= D253), E257 (= E258), H275 (= H276)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (= V73), V98 (= V101), F146 (≠ L147), L148 (= L149), G149 (= G150), R150 (= R151), I151 (= I152), T170 (≠ N171), R171 (= R172), V199 (≠ C200), P200 (≠ V201), S204 (≠ Q205), T205 (= T206), V226 (= V227), G227 (≠ A228), R228 (= R229), H275 (= H276), A277 (≠ G278)
- binding oxalate ion: G69 (= G72), V70 (= V73), G71 (= G74), R228 (= R229), H275 (= H276)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
39% identity, 86% coverage: 35:299/309 of query aligns to 38:311/334 of 5aovA
- active site: L100 (= L97), R241 (= R229), D265 (= D253), E270 (= E258), H288 (= H276)
- binding glyoxylic acid: M52 (≠ G49), L53 (≠ S50), L53 (≠ S50), Y74 (≠ F71), A75 (≠ G72), V76 (= V73), G77 (= G74), R241 (= R229), H288 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V73), T104 (≠ V101), F158 (≠ L149), G159 (= G150), R160 (= R151), I161 (= I152), S180 (≠ N171), R181 (= R172), A211 (≠ T199), V212 (≠ C200), P213 (≠ V201), T218 (= T206), I239 (≠ V227), A240 (= A228), R241 (= R229), H288 (= H276), G290 (= G278)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
41% identity, 85% coverage: 36:299/309 of query aligns to 39:310/332 of 6biiA
- active site: L99 (= L97), R240 (= R229), D264 (= D253), E269 (= E258), H287 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V73), T103 (≠ V101), G156 (= G148), F157 (≠ L149), G158 (= G150), R159 (= R151), I160 (= I152), A179 (vs. gap), R180 (≠ H170), S181 (≠ N171), K183 (≠ R173), V211 (≠ C200), P212 (≠ V201), E216 (≠ Q205), T217 (= T206), V238 (= V227), A239 (= A228), R240 (= R229), D264 (= D253), H287 (= H276), G289 (= G278)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
42% identity, 80% coverage: 54:299/309 of query aligns to 57:311/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
42% identity, 80% coverage: 54:299/309 of query aligns to 57:311/333 of 2dbqA
- active site: L100 (= L97), R241 (= R229), D265 (= D253), E270 (= E258), H288 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V73), T104 (≠ V101), L158 (= L149), G159 (= G150), R160 (= R151), I161 (= I152), S180 (≠ N171), R181 (= R172), T182 (≠ R173), A211 (≠ T199), V212 (≠ C200), P213 (≠ V201), T218 (= T206), I239 (≠ V227), A240 (= A228), R241 (= R229), D265 (= D253), H288 (= H276), G290 (= G278)
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
37% identity, 75% coverage: 65:296/309 of query aligns to 71:309/324 of 2gcgA
- active site: L103 (= L97), R241 (= R229), D265 (= D253), E270 (= E258), H289 (= H276)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G72), V79 (= V73), G80 (= G74), R241 (= R229), H289 (= H276)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V73), T107 (≠ V101), G156 (= G148), G158 (= G150), I160 (= I152), G180 (≠ N171), R181 (= R172), R184 (≠ L175), C212 (= C200), S213 (≠ V201), T218 (= T206), I239 (≠ V227), R241 (= R229), D265 (= D253), H289 (= H276), G291 (= G278)
Sites not aligning to the query:
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
37% identity, 75% coverage: 65:296/309 of query aligns to 75:313/328 of Q9UBQ7
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
37% identity, 81% coverage: 35:285/309 of query aligns to 34:287/304 of 1wwkA
- active site: S96 (≠ L97), R230 (= R229), D254 (= D253), E259 (= E258), H278 (= H276)
- binding nicotinamide-adenine-dinucleotide: V100 (= V101), G146 (= G148), F147 (≠ L149), G148 (= G150), R149 (= R151), I150 (= I152), Y168 (≠ H170), D169 (≠ N171), P170 (≠ R172), V201 (≠ C200), P202 (≠ V201), T207 (= T206), T228 (≠ V227), S229 (≠ A228), D254 (= D253), H278 (= H276), G280 (= G278)
2w2lA Crystal structure of the holo forms of rhodotorula graminis d- mandelate dehydrogenase at 2.5a.
34% identity, 83% coverage: 52:308/309 of query aligns to 67:337/346 of 2w2lA
- active site: G113 (≠ L97), R257 (= R229), D281 (= D253), E286 (= E258), H304 (= H276)
- binding nicotinamide-adenine-dinucleotide: T117 (≠ V101), G172 (= G150), A173 (≠ R151), I174 (= I152), D194 (≠ N171), V228 (≠ C200), P229 (≠ V201), T234 (= T206), T255 (≠ V227), A256 (= A228), R257 (= R229), H304 (= H276), G306 (= G278), G307 (≠ S279)
4e5pA Thermostable phosphite dehydrogenase a176r variant in complex with nad (see paper)
37% identity, 80% coverage: 55:301/309 of query aligns to 58:317/332 of 4e5pA
- active site: L100 (= L97), R237 (= R229), D261 (= D253), E266 (vs. gap), H292 (= H276)
- binding nicotinamide-adenine-dinucleotide: K76 (≠ V73), L100 (= L97), T104 (≠ V101), G154 (= G150), A155 (≠ R151), I156 (= I152), A175 (≠ N171), R176 (= R172), L208 (≠ C200), P209 (≠ V201), T214 (= T206), P235 (≠ V227), C236 (≠ A228), R237 (= R229), H292 (= H276)
4e5mA Thermostable phosphite dehydrogenase e175a/a176r in complex with NADP (see paper)
37% identity, 80% coverage: 55:301/309 of query aligns to 58:317/329 of 4e5mA
- active site: L100 (= L97), R237 (= R229), D261 (= D253), E266 (vs. gap), H292 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K76 (≠ V73), L100 (= L97), T104 (≠ V101), G154 (= G150), A155 (≠ R151), I156 (= I152), R176 (= R172), L208 (≠ C200), P209 (≠ V201), T214 (= T206), P235 (≠ V227), C236 (≠ A228), R237 (= R229), H292 (= H276), G294 (= G278)
4e5kA Thermostable phosphite dehydrogenase in complex with NAD and sulfite (see paper)
37% identity, 80% coverage: 55:301/309 of query aligns to 58:317/329 of 4e5kA
- active site: L100 (= L97), R237 (= R229), D261 (= D253), E266 (vs. gap), H292 (= H276)
- binding nicotinamide-adenine-dinucleotide: K76 (≠ V73), G77 (= G74), L100 (= L97), T104 (≠ V101), G152 (= G148), G154 (= G150), A155 (≠ R151), I156 (= I152), H174 (= H170), E175 (≠ N171), A176 (≠ R172), A207 (≠ T199), L208 (≠ C200), P209 (≠ V201), P235 (≠ V227), C236 (≠ A228), R237 (= R229), D261 (= D253), H292 (= H276), G294 (= G278)
- binding sulfite ion: L75 (≠ G72), K76 (≠ V73), G77 (= G74), L100 (= L97), R237 (= R229), H292 (= H276)
Sites not aligning to the query:
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 80% coverage: 38:285/309 of query aligns to 40:288/305 of 6plfA
7dkmA Phgdh covalently linked to oridonin (see paper)
33% identity, 80% coverage: 38:285/309 of query aligns to 40:288/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V73), A102 (≠ V101), G148 (= G148), R151 (= R151), I152 (= I152), Y170 (≠ H170), D171 (≠ N171), P172 (≠ R172), I173 (≠ R173), H202 (≠ T199), T203 (≠ C200), P204 (≠ V201), T209 (= T206), C230 (≠ V227), A231 (= A228), R232 (= R229), H279 (= H276), G281 (= G278)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
33% identity, 80% coverage: 38:285/309 of query aligns to 39:287/303 of 6plgA
Query Sequence
>GFF377 FitnessBrowser__psRCH2:GFF377
MAYLLQVAPLSARLDRELASRYDILSLWQAETAARLDELADAIEVVVTGSRFGCSAELMA
RLPALKAIVSFGVGYDPIDVPAAQARGIAISNTPEVLNDCVADLAMGLIIDGRRQLSRAD
RFVRAGGWPSGNLPLARRVTGSRLGILGLGRIGHAVAKRAEGFSMPVRYHNRRPLADCPY
EYAGSLVELARWADVLLLTCVGGPQTRGLVSREVLDALGPDGLLVNVARGSVVDEPALVE
ALQAGRLGGAALDVFAEEPQAPEALLGMDNVVLLPHIGSATRETRGAMEDLVLANLQRFL
AEGQLVTPV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory