Comparing GFF3770 FitnessBrowser__Phaeo:GFF3770 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
34% identity, 98% coverage: 1:303/309 of query aligns to 1:316/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
35% identity, 98% coverage: 2:303/309 of query aligns to 1:305/310 of 4fwiB
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
39% identity, 78% coverage: 4:245/309 of query aligns to 3:246/253 of 7z15I
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
39% identity, 78% coverage: 4:244/309 of query aligns to 2:237/241 of 4u00A
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
39% identity, 78% coverage: 4:245/309 of query aligns to 3:246/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
39% identity, 78% coverage: 4:245/309 of query aligns to 3:246/250 of 7z16I
3c4jA Abc protein artp in complex with atp-gamma-s
38% identity, 78% coverage: 4:244/309 of query aligns to 3:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
38% identity, 78% coverage: 4:244/309 of query aligns to 3:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
38% identity, 78% coverage: 4:244/309 of query aligns to 3:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
38% identity, 78% coverage: 4:244/309 of query aligns to 3:239/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
39% identity, 77% coverage: 7:244/309 of query aligns to 4:237/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 81% coverage: 16:264/309 of query aligns to 17:261/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 81% coverage: 16:264/309 of query aligns to 18:262/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 81% coverage: 16:264/309 of query aligns to 18:262/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 81% coverage: 16:264/309 of query aligns to 18:262/344 of 3tuiC
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
30% identity, 99% coverage: 4:309/309 of query aligns to 3:327/330 of P0AAH4
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 78% coverage: 5:246/309 of query aligns to 7:256/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
35% identity, 78% coverage: 5:246/309 of query aligns to 3:252/258 of 1b0uA
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 71% coverage: 15:234/309 of query aligns to 16:232/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 71% coverage: 15:234/309 of query aligns to 16:232/353 of 1oxvA
Sites not aligning to the query:
>GFF3770 FitnessBrowser__Phaeo:GFF3770
MSAILEVNDLQTSYGSVNVLAGVSFTVEQGETYAMVGESGSGKTTVIRAIAGLAPAQAGS
VKFDGQEIRGISEKAFRPLRKDIAMMFQDPTGSLSPRLTIRNLITEPYKIQGMKDRDLEA
EAKRLLELVNLPAHFADRYPYQLSGGQARRVGVARALALEPKLILADEPTAGLDVSVQGE
LLNLLNDLRERLGLSMVIITHNLNVVRHVADRMGILYLGRLVEEGTTEAIFQDPRHPYTN
CLLSANPEPDPDARLDRIALKGEPPSLIQRPSGCEFRDRCPIASDICTQVPAWEVDDGHG
VRCLTPRHL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory