SitesBLAST
Comparing GFF3770 FitnessBrowser__psRCH2:GFF3770 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5odqB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. (see paper)
24% identity, 52% coverage: 175:386/405 of query aligns to 8:239/291 of 5odqB
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G175), C9 (= C176), C41 (= C208), C42 (= C209), C78 (≠ A248), G80 (= G250), C81 (= C251), G152 (≠ P307), C153 (= C308), H154 (≠ T309), C193 (= C340), C194 (= C341), C231 (≠ N378), F233 (≠ G380), C234 (= C381)
- binding 2-bromanylethanesulfonic acid: G46 (vs. gap), G80 (= G250), H154 (≠ T309), G197 (≠ A344), R201 (≠ S348), F233 (≠ G380), L236 (≠ T383)
5odhH Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
24% identity, 52% coverage: 175:386/405 of query aligns to 8:239/291 of 5odhH
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G175), C9 (= C176), C41 (= C208), C42 (= C209), C78 (≠ A248), G80 (= G250), C81 (= C251), C153 (= C308), H154 (≠ T309), C193 (= C340), C194 (= C341), C231 (≠ N378), F233 (≠ G380), C234 (= C381)
- binding 1-thioethanesulfonic acid: A44 (vs. gap), P45 (vs. gap), G46 (vs. gap), G80 (= G250), H154 (≠ T309), G197 (≠ A344), G198 (= G345)
- binding Coenzyme B: R201 (≠ S348), F233 (≠ G380)
Sites not aligning to the query:
5odhB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
24% identity, 52% coverage: 175:386/405 of query aligns to 8:239/291 of 5odhB
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G175), C9 (= C176), I10 (≠ V177), C41 (= C208), C42 (= C209), C78 (≠ A248), G80 (= G250), C81 (= C251), G152 (≠ P307), C153 (= C308), H154 (≠ T309), C193 (= C340), C194 (= C341), C231 (≠ N378), F233 (≠ G380), C234 (= C381)
- binding 1-thioethanesulfonic acid: P45 (vs. gap), G46 (vs. gap), G80 (= G250), F233 (≠ G380)
5odcB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
24% identity, 52% coverage: 175:386/405 of query aligns to 8:239/291 of 5odcB
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G175), C9 (= C176), I10 (≠ V177), C41 (= C208), C42 (= C209), C78 (≠ A248), N79 (≠ S249), G80 (= G250), C81 (= C251), G152 (≠ P307), C153 (= C308), C193 (= C340), C194 (= C341), G197 (≠ A344), C231 (≠ N378), F233 (≠ G380), C234 (= C381)
8b6gCB Succinate dehydrogenase (quinone) (see paper)
26% identity, 26% coverage: 2:108/405 of query aligns to 163:283/285 of 8b6gCB
- binding calcium ion: I222 (vs. gap), D224 (vs. gap), D227 (≠ G62), T230 (= T65)
- binding fe3-s4 cluster: C199 (= C35), S201 (≠ T37), C246 (= C75), Q247 (≠ L76), Q248 (≠ T77), I249 (≠ C78), G250 (≠ R79), M251 (≠ N80), C252 (= C81)
- binding iron/sulfur cluster: C189 (= C25), L191 (≠ H27), C192 (= C28), C195 (= C31), C256 (= C85), K258 (≠ S87)
- binding Ubiquinone-8: P200 (= P36), W204 (≠ L40)
Sites not aligning to the query:
8gymsb NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (see paper)
26% identity, 26% coverage: 2:108/405 of query aligns to 156:276/279 of 8gymsb
- binding fe3-s4 cluster: C192 (= C35), S194 (≠ T37), C239 (= C75), Q240 (≠ L76), Q241 (≠ T77), I242 (≠ C78), G243 (≠ R79), M244 (≠ N80), C245 (= C81), Q256 (vs. gap)
- binding iron/sulfur cluster: C182 (= C25), V183 (= V26), C185 (= C28), A186 (≠ G29), C188 (= C31), A206 (≠ R49), C249 (= C85)
- binding ubiquinone-10: P193 (= P36), W197 (≠ L40), Q240 (≠ L76), I242 (≠ C78)
Sites not aligning to the query:
Q007T0 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; EC 1.3.5.1 from Sus scrofa (Pig) (see paper)
32% identity, 19% coverage: 12:89/405 of query aligns to 171:257/280 of Q007T0
- C186 (= C25) binding
- C189 (= C28) binding
- C192 (= C31) binding
- C196 (= C35) binding
- W201 (≠ L40) binding
- C243 (= C75) binding
- C249 (= C81) binding
- C253 (= C85) binding
Sites not aligning to the query:
- 93 binding
- 98 binding
- 101 binding
- 113 binding
8gs8B Cryo-em structure of the human respiratory complex ii (see paper)
32% identity, 19% coverage: 12:89/405 of query aligns to 137:223/239 of 8gs8B
- binding fe3-s4 cluster: C162 (= C35), Y172 (≠ L45), P175 (= P48), C209 (= C75), H210 (≠ L76), T211 (= T77), I212 (≠ C78), M213 (≠ R79), N214 (= N80), C215 (= C81)
- binding iron/sulfur cluster: C152 (= C25), C155 (= C28), C158 (= C31), A176 (≠ R49), C219 (= C85)
- binding ubiquinone-1: P163 (= P36), W167 (≠ L40), I212 (≠ C78)
Sites not aligning to the query:
5t61L Tungsten formylmethanofuran dehydrogenase subunit fwdF (see paper)
30% identity, 20% coverage: 25:105/405 of query aligns to 70:139/348 of 5t61L
- binding iron/sulfur cluster: C70 (= C25), V71 (= V26), L72 (≠ H27), C73 (= C28), G74 (= G29), C76 (= C31), C80 (= C35), L85 (= L41), C114 (= C75), C117 (= C78), K118 (≠ R79), C120 (= C81), C124 (= C85), I129 (≠ L95)
Sites not aligning to the query:
- binding iron/sulfur cluster: 30, 31, 32, 33, 34, 36, 40, 41, 146, 153, 156, 159, 163, 164, 168, 186, 193, 195, 196, 197, 199, 203, 204, 208, 212, 215, 238, 239, 240, 241, 242, 244, 248, 249, 270, 272, 273, 274, 276, 280, 281, 284, 307, 308, 309, 310, 311, 313, 317
3sfeB Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole (see paper)
32% identity, 19% coverage: 12:89/405 of query aligns to 136:222/240 of 3sfeB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85), P219 (= P86), K220 (≠ S87), L222 (≠ V89)
- binding 2-(1,3-thiazol-4-yl)-1h-benzimidazole: H209 (≠ L76), I211 (≠ C78)
Sites not aligning to the query:
Q9YHT2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; EC 1.3.5.1 from Gallus gallus (Chicken) (see 2 papers)
35% identity, 17% coverage: 22:89/405 of query aligns to 193:267/290 of Q9YHT2
- C196 (= C25) binding
- C199 (= C28) binding
- C202 (= C31) binding
- C206 (= C35) binding
- W211 (≠ L40) binding
- C253 (= C75) binding
- C259 (= C81) binding
- C263 (= C85) binding
Sites not aligning to the query:
- 103 binding
- 108 binding
- 111 binding
- 123 binding
3sfdB Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol (see paper)
32% identity, 19% coverage: 12:89/405 of query aligns to 135:221/239 of 3sfdB
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding pentachlorophenol: P161 (= P36), W165 (≠ L40), I210 (≠ C78)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C85), P218 (= P86), K219 (≠ S87)
Sites not aligning to the query:
3aegB Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
32% identity, 19% coverage: 12:89/405 of query aligns to 135:221/239 of 3aegB
- binding N-biphenyl-3-yl-2-iodobenzamide: S162 (≠ T37), W164 (≠ Q39), W165 (≠ L40), H208 (≠ L76)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), I210 (≠ C78), M211 (≠ R79), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C85)
Sites not aligning to the query:
3aeeB Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
32% identity, 19% coverage: 12:89/405 of query aligns to 135:221/239 of 3aeeB
- binding 3-[(2s,4s,5r)-5,6-dichloro-2,4-dimethyl-1-oxohexyl]-4-hydroxy-5,6-dimethoxy-2(1h)-pyridinone: W165 (≠ L40), H208 (≠ L76), I210 (≠ C78)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C85), P218 (= P86), L221 (≠ V89)
Sites not aligning to the query:
3aedB Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-phenyl-benzamide
32% identity, 19% coverage: 12:89/405 of query aligns to 135:221/239 of 3aedB
- binding 2-iodo-N-phenylbenzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L76), I210 (≠ C78)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), C217 (= C85), L221 (≠ V89)
Sites not aligning to the query:
3aecB Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(1-methylethyl)-benzamid
32% identity, 19% coverage: 12:89/405 of query aligns to 135:221/239 of 3aecB
- binding 2-iodo-N-(1-methylethyl)benzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L76)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C85), P218 (= P86), L221 (≠ V89)
Sites not aligning to the query:
3aebB Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-phenoxy-phenyl)-2-trifluoromethyl-benzamide
32% identity, 19% coverage: 12:89/405 of query aligns to 135:221/239 of 3aebB
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding N-(3-phenoxyphenyl)-2-(trifluoromethyl)benzamide: W165 (≠ L40), H208 (≠ L76)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C85), L221 (≠ V89)
Sites not aligning to the query:
3aeaB Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide (see paper)
32% identity, 19% coverage: 12:89/405 of query aligns to 135:221/239 of 3aeaB
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding N-{3-[(dimethylamino)methyl]phenyl}-2-(trifluoromethyl)benzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L76), I210 (≠ C78)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C85), P218 (= P86), L221 (≠ V89)
Sites not aligning to the query:
3ae9B Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-pentafluorophenyloxy-phenyl)-2-trifluoromethyl-benzamide (see paper)
32% identity, 19% coverage: 12:89/405 of query aligns to 135:221/239 of 3ae9B
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), H208 (≠ L76), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding N-[3-(pentafluorophenoxy)phenyl]-2-(trifluoromethyl)benzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L76)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C85), L221 (≠ V89)
Sites not aligning to the query:
3ae8B Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-2-trifluoromethylbenzamide
32% identity, 19% coverage: 12:89/405 of query aligns to 135:221/239 of 3ae8B
- binding fe3-s4 cluster: C160 (= C35), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), C213 (= C81)
- binding N-[3-(1-methylethoxy)phenyl]-2-(trifluoromethyl)benzamide: S162 (≠ T37), W165 (≠ L40), H208 (≠ L76)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C85), P218 (= P86), L221 (≠ V89)
Sites not aligning to the query:
Query Sequence
>GFF3770 FitnessBrowser__psRCH2:GFF3770
MQTNLSEAAKKLPRAEEAESILRSCVHCGFCNATCPTYQLLGDELDGPRGRIYLMKQMFE
GGEVTESTQLHLDRCLTCRNCETTCPSGVKYHNLLDIGRDFIEQQVQRPLGERVVRGGLR
TVIPRPGLFKALLGAGNALKPLMPASLKDHLPREIRPAKPRPQVMHSRRVLILEGCVQPS
LSPSTNAAAARVLDRLGISVSPAREAGCCGAVDYHLNAQDAGLDRARRNIDAWWPAIEAG
AEAIVQTASGCGAFVKEYGHLLKDDPAYAAKAARVSELAKDLVEVLRSAELEKLNVRADK
RMAFHCPCTLQHAQKLGGAVEDVLTRLGYQLTAVPDAHLCCGSAGSYSITQPEISHQLRD
NKLNALESGKPEVIVTANIGCQTHLDGAGRTPVKHWIEVVEESMQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory