SitesBLAST
Comparing GFF3771 FitnessBrowser__psRCH2:GFF3771 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
33% identity, 48% coverage: 16:183/353 of query aligns to 61:228/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ I28), G75 (= G30), S76 (= S31), G77 (= G32), T78 (≠ S33), G79 (≠ S35), L80 (≠ F36), A83 (≠ L39), C84 (≠ Q40), P137 (= P90), G138 (≠ P91), E139 (≠ H92), A142 (= A97), T143 (= T98), G146 (= G101), N147 (≠ M102), S149 (≠ A104), T150 (≠ A105), A152 (≠ L107), G153 (≠ S108), E203 (≠ F158), G204 (= G159), I209 (≠ L164)
Sites not aligning to the query:
5ae3A Ether lipid-generating enzyme agps in complex with antimycin a (see paper)
31% identity, 45% coverage: 16:175/353 of query aligns to 128:291/539 of 5ae3A
- binding flavin-adenine dinucleotide: P140 (≠ I28), I141 (≠ Q29), G142 (= G30), G143 (≠ S31), G144 (= G32), T145 (≠ S33), S146 (≠ K34), V147 (≠ S35), L151 (= L39), P208 (= P90), D209 (≠ P91), S210 (≠ H92), S214 (≠ A97), T215 (= T98), G218 (= G101), W219 (≠ M102), S221 (≠ A104), T222 (≠ A105), A224 (≠ L107), S225 (= S108), E274 (≠ F158), V279 (= V163), I280 (≠ L164)
Sites not aligning to the query:
- binding [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-dimethyl-4,9-bis(oxidanylidene)-1,5-dioxonan-7-yl] 3-methylbutanoate: 45, 49, 53, 325, 327, 331, 334, 349, 386, 393, 396, 400, 447, 461
- binding flavin-adenine dinucleotide: 497
5ae1B Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
31% identity, 45% coverage: 16:175/353 of query aligns to 128:291/539 of 5ae1B
- binding flavin-adenine dinucleotide: P140 (≠ I28), I141 (≠ Q29), G142 (= G30), G143 (≠ S31), G144 (= G32), T145 (≠ S33), S146 (≠ K34), G150 (= G38), L151 (= L39), P208 (= P90), D209 (≠ P91), S210 (≠ H92), S214 (≠ A97), T215 (= T98), G218 (= G101), W219 (≠ M102), S221 (≠ A104), T222 (≠ A105), A224 (≠ L107), S225 (= S108), E274 (≠ F158), V279 (= V163), I280 (≠ L164)
Sites not aligning to the query:
5adzC Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
31% identity, 45% coverage: 16:175/353 of query aligns to 142:305/557 of 5adzC
- binding flavin-adenine dinucleotide: P154 (≠ I28), I155 (≠ Q29), G156 (= G30), G157 (≠ S31), G158 (= G32), T159 (≠ S33), S160 (≠ K34), P222 (= P90), D223 (≠ P91), S224 (≠ H92), S228 (≠ A97), T229 (= T98), G232 (= G101), W233 (≠ M102), S235 (≠ A104), T236 (≠ A105), A238 (≠ L107), S239 (= S108), E288 (≠ F158), G289 (= G159), I294 (≠ L164)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D223 (≠ P91)
Sites not aligning to the query:
4bc9A Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
31% identity, 45% coverage: 16:175/353 of query aligns to 133:296/555 of 4bc9A
- binding propanenitrile: D214 (≠ P91)
- binding flavin-adenine dinucleotide: P145 (≠ I28), I146 (≠ Q29), G147 (= G30), G148 (≠ S31), G149 (= G32), T150 (≠ S33), S151 (≠ K34), V152 (≠ S35), G155 (= G38), L156 (= L39), P213 (= P90), D214 (≠ P91), S215 (≠ H92), S219 (≠ A97), T220 (= T98), G223 (= G101), W224 (≠ M102), S226 (≠ A104), T227 (≠ A105), A229 (≠ L107), S230 (= S108), E279 (≠ F158), V284 (= V163), I285 (≠ L164)
Sites not aligning to the query:
5ae2B Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
31% identity, 45% coverage: 16:175/353 of query aligns to 128:291/542 of 5ae2B
- binding flavin-adenine dinucleotide: P140 (≠ I28), G142 (= G30), G143 (≠ S31), G144 (= G32), T145 (≠ S33), S146 (≠ K34), G150 (= G38), L151 (= L39), P208 (= P90), D209 (≠ P91), S210 (≠ H92), S214 (≠ A97), T215 (= T98), G218 (= G101), W219 (≠ M102), S221 (≠ A104), T222 (≠ A105), A224 (≠ L107), S225 (= S108), E274 (≠ F158), G275 (= G159), V279 (= V163), I280 (≠ L164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 500
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 399, 409, 410, 411, 462, 464, 466, 500, 501
4bc9B Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
31% identity, 45% coverage: 16:175/353 of query aligns to 128:291/542 of 4bc9B
- binding propanenitrile: D209 (≠ P91)
- binding flavin-adenine dinucleotide: P140 (≠ I28), G142 (= G30), G143 (≠ S31), G144 (= G32), T145 (≠ S33), S146 (≠ K34), V147 (≠ S35), G150 (= G38), L151 (= L39), P208 (= P90), D209 (≠ P91), S210 (≠ H92), S214 (≠ A97), T215 (= T98), G218 (= G101), W219 (≠ M102), S221 (≠ A104), T222 (≠ A105), A224 (≠ L107), S225 (= S108), E274 (≠ F158), G275 (= G159), I280 (≠ L164)
Sites not aligning to the query:
6gouA Development of alkyl glycerone phosphate synthase inhibitors: complex with inhibitor 2i (see paper)
31% identity, 45% coverage: 16:175/353 of query aligns to 142:305/554 of 6gouA
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: D223 (≠ P91)
- binding flavin-adenine dinucleotide: P154 (≠ I28), I155 (≠ Q29), G156 (= G30), G157 (≠ S31), G158 (= G32), T159 (≠ S33), S160 (≠ K34), V161 (≠ S35), G164 (= G38), P222 (= P90), D223 (≠ P91), S224 (≠ H92), S228 (≠ A97), T229 (= T98), G232 (= G101), W233 (≠ M102), S235 (≠ A104), T236 (≠ A105), A238 (≠ L107), S239 (= S108), E288 (≠ F158), V293 (= V163), I294 (≠ L164)
Sites not aligning to the query:
5ae2A Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
31% identity, 45% coverage: 16:175/353 of query aligns to 133:296/561 of 5ae2A
- binding flavin-adenine dinucleotide: P145 (≠ I28), I146 (≠ Q29), G147 (= G30), G148 (≠ S31), G149 (= G32), T150 (≠ S33), S151 (≠ K34), G155 (= G38), L156 (= L39), P213 (= P90), D214 (≠ P91), S215 (≠ H92), S219 (≠ A97), T220 (= T98), G223 (= G101), W224 (≠ M102), S226 (≠ A104), T227 (≠ A105), A229 (≠ L107), S230 (= S108), E279 (≠ F158), V284 (= V163), I285 (≠ L164)
Sites not aligning to the query:
4bc7B Mammalian alkyldihydroxyacetonephosphate synthase: arg419his mutant (see paper)
31% identity, 45% coverage: 16:175/353 of query aligns to 128:291/543 of 4bc7B
- binding flavin-adenine dinucleotide: P140 (≠ I28), G142 (= G30), G143 (≠ S31), G144 (= G32), T145 (≠ S33), S146 (≠ K34), V147 (≠ S35), G150 (= G38), L151 (= L39), P208 (= P90), D209 (≠ P91), S210 (≠ H92), S214 (≠ A97), T215 (= T98), G218 (= G101), S221 (≠ A104), T222 (≠ A105), A224 (≠ L107), S225 (= S108), E274 (≠ F158), G275 (= G159), I280 (≠ L164)
Sites not aligning to the query:
5ae1A Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
31% identity, 45% coverage: 16:175/353 of query aligns to 127:290/560 of 5ae1A
- binding flavin-adenine dinucleotide: P139 (≠ I28), I140 (≠ Q29), G141 (= G30), G142 (≠ S31), G143 (= G32), T144 (≠ S33), S145 (≠ K34), V146 (≠ S35), G149 (= G38), L150 (= L39), P207 (= P90), D208 (≠ P91), S209 (≠ H92), S213 (≠ A97), T214 (= T98), G216 (= G100), G217 (= G101), W218 (≠ M102), S220 (≠ A104), T221 (≠ A105), A223 (≠ L107), S224 (= S108), E273 (≠ F158), G274 (= G159), V278 (= V163), I279 (≠ L164)
Sites not aligning to the query:
P97275 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Cavia porcellus (Guinea pig) (see 4 papers)
31% identity, 45% coverage: 16:175/353 of query aligns to 222:385/658 of P97275
- 234:240 (vs. 28:34, 29% identical) binding
- H300 (≠ C88) mutation to A: Loss of activity.
- 303:309 (vs. 91:98, 25% identical) binding
- T309 (= T98) mutation to I: Impaired FAD binding and protein stability. Loss of activity.
- TRAS 316:319 (≠ AGLS 105:108) binding
- S367 (= S157) mutation to A: Strongly reduced activity.
- 368:374 (vs. 158:164, 57% identical) binding
Sites not aligning to the query:
- 1:58 modified: transit peptide, Peroxisome
- 419 Important for enzyme activity; R→H: Loss of activity.; R→K: Strongly reduced activity.
- 469 L→P: Impaired FAD binding and protein stability. Loss of activity.
- 515 binding ; R→L: Impaired FAD binding and protein stability. Loss of activity.
- 576 C→A: No effect on activity.
- 578 active site, Proton donor/acceptor; Y→F: Loss of activity.
- 615 H→A: Loss of activity.
- 615:617 Important for enzyme activity
- 616 H→A: Loss of activity.
- 617 H→A: Loss of activity.
- 654:658 Important for enzyme activity
5adzA Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
31% identity, 45% coverage: 16:175/353 of query aligns to 130:293/566 of 5adzA
- binding flavin-adenine dinucleotide: P142 (≠ I28), I143 (≠ Q29), G144 (= G30), G145 (≠ S31), G146 (= G32), T147 (≠ S33), S148 (≠ K34), G152 (= G38), P210 (= P90), D211 (≠ P91), S212 (≠ H92), S216 (≠ A97), T217 (= T98), G220 (= G101), W221 (≠ M102), S223 (≠ A104), T224 (≠ A105), A226 (≠ L107), S227 (= S108), E276 (≠ F158), G277 (= G159), V281 (= V163), I282 (≠ L164)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D211 (≠ P91)
Sites not aligning to the query:
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
31% identity, 38% coverage: 43:176/353 of query aligns to 85:218/455 of 8jdxA
- binding flavin-adenine dinucleotide: L90 (≠ T48), P132 (= P90), G133 (= G94), A134 (≠ E95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ F158), G201 (= G159), I206 (≠ L164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 322, 413, 414, 450
- binding 3-methyl-2-oxobutanoic acid: 318, 369, 376, 414
- binding manganese (ii) ion: 369, 376, 413
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
32% identity, 38% coverage: 43:175/353 of query aligns to 85:217/456 of 8jdsA
- binding flavin-adenine dinucleotide: L90 (≠ T48), P132 (= P90), G133 (= G94), A134 (≠ E95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ F158), G201 (= G159), I206 (≠ L164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 323, 414, 415, 451
- binding manganese (ii) ion: 370, 377, 414
- binding pyruvic acid: 319, 370, 377, 415
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
32% identity, 38% coverage: 43:175/353 of query aligns to 85:217/454 of 8jdzA
- binding flavin-adenine dinucleotide: L90 (≠ T48), P132 (= P90), G133 (= G94), A134 (≠ E95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ F158), G201 (= G159), I206 (≠ L164)
Sites not aligning to the query:
- binding (3S)-3-methyl-2-oxopentanoic acid: 318, 322, 369, 376, 413
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 322, 412, 413, 449
- binding manganese (ii) ion: 369, 376, 412
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
32% identity, 38% coverage: 43:175/353 of query aligns to 85:217/454 of 8jdyA
- binding flavin-adenine dinucleotide: L90 (≠ T48), P132 (= P90), G133 (= G94), A134 (≠ E95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ F158), G201 (= G159), I206 (≠ L164)
Sites not aligning to the query:
- binding 2-oxo-4-methylpentanoic acid: 318, 322, 336, 369, 376, 413
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 412, 449
- binding manganese (ii) ion: 369, 376, 412
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
32% identity, 38% coverage: 43:175/353 of query aligns to 85:217/455 of 8jdtA
- binding flavin-adenine dinucleotide: L90 (≠ T48), P132 (= P90), G133 (= G94), A134 (≠ E95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ F158), G201 (= G159), I206 (≠ L164)
Sites not aligning to the query:
- binding 2-ketobutyric acid: 318, 369, 376, 414
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 322, 413, 414, 450
- binding manganese (ii) ion: 369, 376, 413
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
31% identity, 38% coverage: 43:176/353 of query aligns to 85:218/455 of 8jdeA
- binding flavin-adenine dinucleotide: L90 (≠ T48), P132 (= P90), G133 (= G94), A134 (≠ E95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ F158), G201 (= G159), I206 (≠ L164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 322, 413, 414, 450
- binding lactic acid: 318, 369, 376, 414
- binding manganese (ii) ion: 369, 376, 413
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
32% identity, 38% coverage: 43:175/353 of query aligns to 85:217/456 of 8jdrA
- binding flavin-adenine dinucleotide: L90 (≠ T48), P132 (= P90), G133 (= G94), A134 (≠ E95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ F158), G201 (= G159), I206 (≠ L164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 324, 370, 414, 451
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: 319, 323, 415
Query Sequence
>GFF3771 FitnessBrowser__psRCH2:GFF3771
MSVIANDASAQLLDQVNQALAANTPLRIQGSGSKSFLGLQADGVLLDTREHRGIVSYDPT
ELVVTVRAGTPLTELETALDEAGQMLPCEPPHFGEGATVGGMIAAGLSGPRRPWSGSVRD
FVLGSRVITGQGKHLRFGGEVMKNVAGYDLSRLMAGSFGCLGVLTEVSLKVLPKPRLCTS
LRLEIDLERALLKLAEWGQQPIPISAASHDGQALHLRLEGGEGSVGAARERIGGEDLDPG
YWNDLREQRLAFFADPRPLWRLSLPNNTPALGLPGDQLVDWAGAQRWLKSDADAVTIRGI
AIEVGGHATCFTAGATTNPFQPLAAPLLRYHRQLKAALDPQGIFNPGRMYSEV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory