Comparing GFF3784 FitnessBrowser__psRCH2:GFF3784 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 91% coverage: 21:262/266 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 91% coverage: 21:262/266 of query aligns to 4:253/254 of 1g6hA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
28% identity, 89% coverage: 21:258/266 of query aligns to 4:236/501 of P04983
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 91% coverage: 22:264/266 of query aligns to 3:237/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 91% coverage: 22:264/266 of query aligns to 3:237/238 of 6s8gA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 91% coverage: 21:262/266 of query aligns to 2:235/240 of 6mjpA
6mbnA Lptb e163q in complex with atp (see paper)
31% identity, 92% coverage: 19:264/266 of query aligns to 1:238/241 of 6mbnA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 91% coverage: 22:262/266 of query aligns to 3:235/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 90% coverage: 22:261/266 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 90% coverage: 22:261/266 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 90% coverage: 22:260/266 of query aligns to 3:233/233 of 6b8bA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
30% identity, 91% coverage: 20:262/266 of query aligns to 5:238/240 of 1ji0A
E9Q876 Glucosylceramide transporter ABCA12; ATP-binding cassette sub-family A member 12; EC 7.6.2.1 from Mus musculus (Mouse) (see 2 papers)
28% identity, 90% coverage: 6:245/266 of query aligns to 1335:1559/2595 of E9Q876
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 89% coverage: 21:257/266 of query aligns to 3:235/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 89% coverage: 21:257/266 of query aligns to 3:235/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 89% coverage: 21:257/266 of query aligns to 3:235/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 89% coverage: 21:257/266 of query aligns to 3:235/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 89% coverage: 21:257/266 of query aligns to 2:233/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 89% coverage: 21:257/266 of query aligns to 1:233/240 of 4ymuJ
7e7oA Cryo-em structure of human abca4 in nrpe-bound state (see paper)
28% identity, 79% coverage: 35:245/266 of query aligns to 823:1021/2003 of 7e7oA
Sites not aligning to the query:
>GFF3784 FitnessBrowser__psRCH2:GFF3784
MSMAAVHPNPTGNAGRDATVMLSARGLRKEFGGFVAVNNVDLDVRHAQVHALIGPNGAGK
TTVFNLLTKFLQPSAGSIRLLDHDITRTDPAKVARMGLVRSFQISAVFPHLTVLDNVRVA
LQRPGGLATQFWLPMRSLNRLNERALQLIESVGLADKRHELAADLSYGRKRVLEIATTLA
LEPKVLLLDEPMAGMGHEDVHVVAEIIREVATQRAVLMVEHNLKVVADLCHQVTVLQRGE
ILTSGDYRTVSQDERVRVAYMGTDDD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory