Comparing GFF3790 FitnessBrowser__Marino:GFF3790 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yslA Crystal structure of sdoa from pseudomonas putida in complex with glutathione (see paper)
51% identity, 93% coverage: 16:296/302 of query aligns to 8:294/294 of 4yslA
4yskA Crystal structure of apo-form sdoa from pseudomonas putida (see paper)
51% identity, 93% coverage: 16:296/302 of query aligns to 8:294/294 of 4yskA
4efzA Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
49% identity, 94% coverage: 13:296/302 of query aligns to 3:295/295 of 4efzA
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
33% identity, 85% coverage: 20:276/302 of query aligns to 6:224/225 of 4ysbA
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
29% identity, 85% coverage: 20:276/302 of query aligns to 28:248/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
29% identity, 85% coverage: 20:276/302 of query aligns to 12:232/237 of 4chlB
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
28% identity, 87% coverage: 20:282/302 of query aligns to 9:236/350 of 5ve5A
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 81% coverage: 32:276/302 of query aligns to 72:285/294 of Q9C8L4
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
29% identity, 85% coverage: 20:276/302 of query aligns to 8:236/244 of 2gcuA
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
27% identity, 87% coverage: 20:281/302 of query aligns to 10:252/336 of 3r2uB
Sites not aligning to the query:
3r2uA 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
26% identity, 87% coverage: 20:281/302 of query aligns to 8:264/348 of 3r2uA
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
27% identity, 86% coverage: 20:278/302 of query aligns to 8:262/473 of 3tp9A
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
24% identity, 90% coverage: 30:301/302 of query aligns to 15:244/254 of 2q42A
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 90% coverage: 30:301/302 of query aligns to 85:314/324 of Q9SID3
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
29% identity, 69% coverage: 36:242/302 of query aligns to 22:210/210 of 2xf4A
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 88% coverage: 30:296/302 of query aligns to 15:246/258 of O24496
Sites not aligning to the query:
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
26% identity, 70% coverage: 30:241/302 of query aligns to 15:208/209 of 7ev5A
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
28% identity, 59% coverage: 62:240/302 of query aligns to 34:200/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
28% identity, 59% coverage: 62:240/302 of query aligns to 32:198/198 of 2zziA
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
26% identity, 65% coverage: 19:215/302 of query aligns to 10:185/202 of 7l0bA
>GFF3790 FitnessBrowser__Marino:GFF3790
MRTFQQSPAKHAGTPNVAGFFDPRTFSVQYVVSDPETKQCAIIDPVLDYDEKSGATATHH
ADELLAFIREQGFEVQWILDTHPHADHFSAAQYLKEQTGAPTAIGGYVTGVQELWKGIYN
WPDFPADGSQWDHLFRAGDEFRVGNLQGRVMFSPGHTLASVTYVIGDAAFVHDTIFQPDF
GTARADFPGGDAHQLWDSIQAILALPDETRLFTGHDYMPGGREPEWESTVGEQKQANKHL
AETSEAEYVELRNTRDSELPMPKLILHALQVNTRGGRLPEPEANGKRYLKIPLDALEGAA
WE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory