Comparing GFF38 FitnessBrowser__Phaeo:GFF38 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
38% identity, 92% coverage: 5:214/228 of query aligns to 3:200/208 of 1fw1A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
38% identity, 92% coverage: 5:214/228 of query aligns to 7:204/216 of O43708
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
36% identity, 92% coverage: 5:214/228 of query aligns to 4:201/212 of 2cz2A
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
36% identity, 92% coverage: 5:214/228 of query aligns to 7:204/216 of Q9WVL0
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
37% identity, 97% coverage: 6:227/228 of query aligns to 10:219/220 of 4kaeA
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
37% identity, 97% coverage: 6:227/228 of query aligns to 12:221/222 of 4kdyA
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
41% identity, 93% coverage: 2:214/228 of query aligns to 1:208/216 of 4pxoA
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
35% identity, 93% coverage: 6:216/228 of query aligns to 5:209/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
35% identity, 93% coverage: 6:216/228 of query aligns to 3:207/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
35% identity, 93% coverage: 6:216/228 of query aligns to 3:207/212 of O86043
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
35% identity, 83% coverage: 6:194/228 of query aligns to 6:197/228 of 3n5oA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
35% identity, 83% coverage: 6:194/228 of query aligns to 8:199/231 of D2YW48
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
28% identity, 83% coverage: 6:194/228 of query aligns to 5:181/201 of 3m3mA
4chsA Crystal structure of a tau class glutathione transferase 10 from glycine max (see paper)
27% identity, 93% coverage: 3:215/228 of query aligns to 3:200/215 of 4chsA
5agyA Crystal structure of a tau class gst mutant from glycine (see paper)
27% identity, 93% coverage: 3:215/228 of query aligns to 4:201/219 of 5agyA
Sites not aligning to the query:
Q12390 Glutathione S-transferase 2; GST-II; EC 2.5.1.18 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 80% coverage: 2:183/228 of query aligns to 17:195/233 of Q12390
3ibhA Crystal structure of saccharomyces cerevisiae gtt2 in complex with glutathione (see paper)
30% identity, 79% coverage: 4:183/228 of query aligns to 1:177/208 of 3ibhA
3ergA Crystal structure of gtt2 from saccharomyces cerevisiae in complex with glutathione sulfnate (see paper)
30% identity, 79% coverage: 4:183/228 of query aligns to 1:177/208 of 3ergA
1pn9A Crystal structure of an insect delta-class glutathione s-transferase from a ddt-resistant strain of the malaria vector anopheles gambiae (see paper)
24% identity, 87% coverage: 18:216/228 of query aligns to 15:200/209 of 1pn9A
Sites not aligning to the query:
7zvpA Crystal structure of poplar glutathione transferase u19 in complex with glutathione (see paper)
36% identity, 41% coverage: 2:95/228 of query aligns to 1:93/216 of 7zvpA
>GFF38 FitnessBrowser__Phaeo:GFF38
MSDVILYDYWRSSASYRVRIALNLAGISYRAVTVDLVKGEQVSPDHLARNPQGLVPVLEI
DGLRLTQSLAILDYLDQTRHLDLLPRTPAERALAQALAHAIAVDLHPVCNLKVARHASDL
CTGSAASPAAQPVDMPADWMRHFIRPGLVAFNTLLEEHPVAPYCTGDHPGLADLCLIPQL
YNARRWGVNFDDLPRLVTIETTCAGNPAFAMAHPDAVHTLDPPQKQTE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory