SitesBLAST
Comparing GFF3828 FitnessBrowser__Phaeo:GFF3828 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
31% identity, 84% coverage: 10:473/551 of query aligns to 7:456/539 of 6lpiB
- active site: I27 (= I30), G29 (= G32), G30 (≠ V33), S31 (≠ H34), I32 (≠ T35), E53 (= E55), C76 (≠ I78), F115 (≠ L119), Q116 (≠ H120), E117 (= E121), K165 (≠ L173), M256 (≠ S264), A283 (= A294), V375 (≠ S391), G401 (= G418), M403 (≠ L420), D428 (= D445), N455 (= N472)
- binding flavin-adenine dinucleotide: R155 (= R163), G212 (= G221), G213 (= G222), G214 (= G223), T236 (= T245), L237 (≠ V246), M238 (≠ N247), L254 (≠ S262), M256 (≠ S264), H257 (≠ L265), G276 (= G282), A277 (≠ T283), R278 (≠ E284), D280 (= D291), R282 (≠ Y293), A283 (= A294), D300 (= D308), I301 (≠ L309), D319 (= D326), V320 (= V327), M380 (≠ Y396), G398 (≠ A414)
- binding magnesium ion: D428 (= D445), N455 (= N472)
- binding thiamine diphosphate: E53 (= E55), C76 (≠ I78), P79 (= P81), G376 (≠ A392), Q377 (= Q393), H378 (≠ P394), G401 (= G418), M403 (≠ L420), G427 (= G444), D428 (= D445), G429 (= G446), S430 (≠ G447), M433 (≠ F450), N455 (= N472)
Sites not aligning to the query:
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ S264), R292 (≠ Y293)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ D390), G401 (≠ S391), Q402 (≠ A392), H403 (≠ Q393), G426 (= G418), M428 (≠ L420), G452 (= G444), D453 (= D445), G454 (= G446), S455 (≠ G447), L483 (≠ I478), G484 (≠ A479), M485 (≠ R480), V486 (≠ S481)
- binding flavin-adenine dinucleotide: R161 (= R163), G222 (= G221), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), M263 (≠ A261), L264 (≠ S262), M266 (≠ S264), H267 (≠ L265), G286 (= G282), R288 (≠ E284), V293 (≠ A294), D310 (= D308), I311 (≠ L309), D329 (= D326), V330 (= V327), M405 (≠ I395), G423 (≠ A414)
- binding magnesium ion: A37 (≠ H34), T82 (≠ I78), S83 (≠ T79), Q122 (≠ H120), Y381 (vs. gap), D453 (= D445), M458 (≠ F450), Q461 (≠ P453), N480 (= N472), H482 (≠ E477)
Sites not aligning to the query:
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ D390), G401 (≠ S391), Q402 (≠ A392), H403 (≠ Q393), G426 (= G418), M428 (≠ L420), G452 (= G444), D453 (= D445), G454 (= G446), S455 (≠ G447), M458 (≠ F450), N480 (= N472), H482 (≠ E477), L483 (≠ I478), G484 (≠ A479), M485 (≠ R480), V486 (≠ S481)
- binding flavin-adenine dinucleotide: R161 (= R163), G222 (= G221), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), L264 (≠ S262), M266 (≠ S264), H267 (≠ L265), G286 (= G282), V287 (≠ T283), R288 (≠ E284), D290 (= D291), R292 (≠ Y293), V293 (≠ A294), D310 (= D308), I311 (≠ L309), D329 (= D326), V330 (= V327), M405 (≠ I395), G423 (≠ A414)
- binding magnesium ion: F370 (≠ W361), D453 (= D445), M458 (≠ F450), Q461 (≠ P453), N480 (= N472), H482 (≠ E477)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ S264), R292 (≠ Y293), M485 (≠ R480)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/582 of 5wj1A
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), S38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ L119), Q122 (≠ H120), E123 (= E121), K171 (≠ L173), M266 (≠ S264), V293 (≠ A294), V400 (≠ D390), G426 (= G418), M428 (≠ L420), D453 (= D445), N480 (= N472), H482 (≠ E477), L483 (≠ I478), M485 (≠ R480), V486 (≠ S481)
- binding flavin-adenine dinucleotide: R161 (= R163), G222 (= G221), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), M263 (≠ A261), L264 (≠ S262), G286 (= G282), R288 (≠ E284), V293 (≠ A294), D310 (= D308), I311 (≠ L309), D329 (= D326), V330 (= V327), M405 (≠ I395), G423 (≠ A414), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ E477)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ S264), D291 (≠ M292), R292 (≠ Y293), M485 (≠ R480)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ D390), G401 (≠ S391), Q402 (≠ A392), H403 (≠ Q393), M428 (≠ L420), D453 (= D445), G454 (= G446), S455 (≠ G447), M458 (≠ F450), N480 (= N472), H482 (≠ E477), L483 (≠ I478), G484 (≠ A479), M485 (≠ R480), V486 (≠ S481)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/582 of 5k6tA
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), S38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ L119), Q122 (≠ H120), E123 (= E121), K171 (≠ L173), M266 (≠ S264), V293 (≠ A294), V400 (≠ D390), G426 (= G418), M428 (≠ L420), D453 (= D445), N480 (= N472), H482 (≠ E477), L483 (≠ I478), M485 (≠ R480), V486 (≠ S481)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ L265), R292 (≠ Y293), M485 (≠ R480)
- binding flavin-adenine dinucleotide: R161 (= R163), G222 (= G221), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), L264 (≠ S262), G286 (= G282), R288 (≠ E284), D290 (= D291), R292 (≠ Y293), V293 (≠ A294), D310 (= D308), I311 (≠ L309), D329 (= D326), V330 (= V327), Q404 (≠ P394), M405 (≠ I395), G423 (≠ A414)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ E477)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ D390), G401 (≠ S391), Q402 (≠ A392), H403 (≠ Q393), G426 (= G418), M428 (≠ L420), G452 (= G444), G454 (= G446), S455 (≠ G447), N480 (= N472), H482 (≠ E477), L483 (≠ I478), G484 (≠ A479)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/582 of 5k6rA
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), S38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ L119), Q122 (≠ H120), E123 (= E121), K171 (≠ L173), M266 (≠ S264), V293 (≠ A294), V400 (≠ D390), G426 (= G418), M428 (≠ L420), D453 (= D445), N480 (= N472), H482 (≠ E477), L483 (≠ I478), M485 (≠ R480), V486 (≠ S481)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ Y293)
- binding flavin-adenine dinucleotide: R161 (= R163), G222 (= G221), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), L264 (≠ S262), M266 (≠ S264), G286 (= G282), R288 (≠ E284), R292 (≠ Y293), V293 (≠ A294), D310 (= D308), I311 (≠ L309), G328 (= G325), D329 (= D326), V330 (= V327), M405 (≠ I395), G423 (≠ A414)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ E477)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ D390), G401 (≠ S391), Q402 (≠ A392), H403 (≠ Q393), G426 (= G418), M428 (≠ L420), D453 (= D445), G454 (= G446), S455 (≠ G447), M458 (≠ F450), N480 (= N472), H482 (≠ E477), L483 (≠ I478), G484 (≠ A479), M485 (≠ R480), V486 (≠ S481)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/582 of 1z8nA
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), S38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ L119), Q122 (≠ H120), E123 (= E121), K171 (≠ L173), M266 (≠ S264), V293 (≠ A294), V400 (≠ D390), G426 (= G418), M428 (≠ L420), D453 (= D445), N480 (= N472), H482 (≠ E477), L483 (≠ I478), M485 (≠ R480), V486 (≠ S481)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (≠ L134), R161 (= R163), Y191 (≠ E193), R194 (= R196), D291 (≠ M292), R292 (≠ Y293), D312 (≠ C310)
- binding flavin-adenine dinucleotide: R161 (= R163), G222 (= G221), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), L264 (≠ S262), G265 (≠ P263), M266 (≠ S264), H267 (≠ L265), G286 (= G282), V287 (≠ T283), R288 (≠ E284), D290 (= D291), R292 (≠ Y293), V293 (≠ A294), D310 (= D308), I311 (≠ L309), D329 (= D326), V330 (= V327), M405 (≠ I395), G423 (≠ A414), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472)
- binding thiamine diphosphate: V400 (≠ D390), G401 (≠ S391), Q402 (≠ A392), H403 (≠ Q393), G426 (= G418), M428 (≠ L420), G452 (= G444), G454 (= G446), S455 (≠ G447), N480 (= N472), H482 (≠ E477), L483 (≠ I478), G484 (≠ A479), M485 (≠ R480), V486 (≠ S481)
Sites not aligning to the query:
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/582 of 1yi1A
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), S38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ L119), Q122 (≠ H120), E123 (= E121), K171 (≠ L173), M266 (≠ S264), V293 (≠ A294), V400 (≠ D390), G426 (= G418), M428 (≠ L420), D453 (= D445), N480 (= N472), H482 (≠ E477), L483 (≠ I478), M485 (≠ R480), V486 (≠ S481)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (≠ M292), R292 (≠ Y293)
- binding flavin-adenine dinucleotide: R161 (= R163), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), M263 (≠ A261), L264 (≠ S262), G265 (≠ P263), M266 (≠ S264), H267 (≠ L265), G286 (= G282), V287 (≠ T283), R288 (≠ E284), D290 (= D291), V293 (≠ A294), D310 (= D308), I311 (≠ L309), D329 (= D326), V330 (= V327), M405 (≠ I395), G423 (≠ A414), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ E477)
Sites not aligning to the query:
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/582 of 1yi0A
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), S38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ L119), Q122 (≠ H120), E123 (= E121), K171 (≠ L173), M266 (≠ S264), V293 (≠ A294), V400 (≠ D390), G426 (= G418), M428 (≠ L420), D453 (= D445), N480 (= N472), H482 (≠ E477), L483 (≠ I478), M485 (≠ R480), V486 (≠ S481)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ M292), R292 (≠ Y293)
- binding flavin-adenine dinucleotide: R161 (= R163), G222 (= G221), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), L264 (≠ S262), G265 (≠ P263), M266 (≠ S264), H267 (≠ L265), G286 (= G282), V287 (≠ T283), R288 (≠ E284), D290 (= D291), R292 (≠ Y293), V293 (≠ A294), D310 (= D308), I311 (≠ L309), G328 (= G325), D329 (= D326), V330 (= V327), M405 (≠ I395), G423 (≠ A414), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ E477)
Sites not aligning to the query:
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/582 of 1yhzA
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), S38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ L119), Q122 (≠ H120), E123 (= E121), K171 (≠ L173), M266 (≠ S264), V293 (≠ A294), V400 (≠ D390), G426 (= G418), M428 (≠ L420), D453 (= D445), N480 (= N472), H482 (≠ E477), L483 (≠ I478), M485 (≠ R480), V486 (≠ S481)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (≠ M292), R292 (≠ Y293), M485 (≠ R480)
- binding flavin-adenine dinucleotide: R161 (= R163), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), L264 (≠ S262), M266 (≠ S264), H267 (≠ L265), G286 (= G282), V287 (≠ T283), R288 (≠ E284), D290 (= D291), V293 (≠ A294), D310 (= D308), I311 (≠ L309), D329 (= D326), V330 (= V327), Q404 (≠ P394), M405 (≠ I395), G423 (≠ A414), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ E477)
Sites not aligning to the query:
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/582 of 1yhyA
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), S38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ L119), Q122 (≠ H120), E123 (= E121), K171 (≠ L173), M266 (≠ S264), V293 (≠ A294), V400 (≠ D390), G426 (= G418), M428 (≠ L420), D453 (= D445), N480 (= N472), H482 (≠ E477), L483 (≠ I478), M485 (≠ R480), V486 (≠ S481)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ M292), R292 (≠ Y293), V486 (≠ S481)
- binding flavin-adenine dinucleotide: R161 (= R163), G222 (= G221), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), L264 (≠ S262), G265 (≠ P263), M266 (≠ S264), H267 (≠ L265), G286 (= G282), V287 (≠ T283), R288 (≠ E284), D290 (= D291), V293 (≠ A294), D310 (= D308), I311 (≠ L309), D329 (= D326), V330 (= V327), Q404 (≠ P394), M405 (≠ I395), G423 (≠ A414), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ E477)
Sites not aligning to the query:
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/582 of 1ybhA
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), S38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ L119), Q122 (≠ H120), E123 (= E121), K171 (≠ L173), M266 (≠ S264), V293 (≠ A294), V400 (≠ D390), G426 (= G418), M428 (≠ L420), D453 (= D445), N480 (= N472), H482 (≠ E477), L483 (≠ I478), M485 (≠ R480), V486 (≠ S481)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (≠ S264), D291 (≠ M292), R292 (≠ Y293), M485 (≠ R480)
- binding flavin-adenine dinucleotide: R161 (= R163), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), L264 (≠ S262), M266 (≠ S264), H267 (≠ L265), G286 (= G282), V287 (≠ T283), R288 (≠ E284), D290 (= D291), V293 (≠ A294), D310 (= D308), I311 (≠ L309), D329 (= D326), V330 (= V327), Q404 (≠ P394), M405 (≠ I395), G423 (≠ A414), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ E477)
Sites not aligning to the query:
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
29% identity, 85% coverage: 13:483/551 of query aligns to 101:573/670 of P17597
- A122 (≠ H34) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ V36) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E55) binding
- S186 (= S97) binding
- P197 (≠ E108) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ G110) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (≠ H120) binding
- K220 (≠ L134) binding
- R246 (= R163) binding ; binding
- K256 (≠ L173) binding
- G308 (= G222) binding
- TL 331:332 (≠ TV 245:246) binding
- C340 (≠ F253) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ SPSL 262:265) binding
- GVR-----FD 371:375 (≠ GTELGPTDYD 282:291) binding
- DR 376:377 (≠ MY 292:293) binding
- DI 395:396 (≠ DL 308:309) binding
- DV 414:415 (= DV 326:327) binding
- QH 487:488 (≠ AQ 392:393) binding
- G-G 508:509 (≠ ATG 414:416) binding
- GAM 511:513 (≠ GAL 418:420) binding
- D538 (= D445) binding
- DGS 538:540 (≠ DGG 445:447) binding
- N565 (= N472) binding
- N---QHLGM 565:570 (≠ NHGYQEIAR 472:480) binding
- H567 (≠ E477) binding
Sites not aligning to the query:
- 574 binding ; W→L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; W→S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- 653 binding ; S→A: No effect on catalytic activity or sensitivity to herbicides.; S→F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; S→N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; S→T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/583 of 5k3sA
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), S38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ L119), Q122 (≠ H120), E123 (= E121), K171 (≠ L173), M266 (≠ S264), V293 (≠ A294), V400 (≠ D390), G426 (= G418), M428 (≠ L420), D453 (= D445), N480 (= N472), H482 (≠ E477), L483 (≠ I478), M485 (≠ R480), V486 (≠ S481)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (≠ Y293), M485 (≠ R480)
- binding flavin-adenine dinucleotide: R161 (= R163), G222 (= G221), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), L264 (≠ S262), M266 (≠ S264), G286 (= G282), R288 (≠ E284), D290 (= D291), V293 (≠ A294), D310 (= D308), I311 (≠ L309), D329 (= D326), V330 (= V327), M405 (≠ I395), G423 (≠ A414)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ E477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ D390), G401 (≠ S391), Q402 (≠ A392), H403 (≠ Q393), G426 (= G418), M428 (≠ L420), D453 (= D445), G454 (= G446), S455 (≠ G447), N480 (= N472), H482 (≠ E477), L483 (≠ I478), G484 (≠ A479), M485 (≠ R480), V486 (≠ S481)
Sites not aligning to the query:
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 16:488/585 of 5k2oA
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), S38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ L119), Q122 (≠ H120), E123 (= E121), K171 (≠ L173), M266 (≠ S264), V293 (≠ A294), V400 (≠ D390), G426 (= G418), M428 (≠ L420), D453 (= D445), N480 (= N472), H482 (≠ E477), L483 (≠ I478), M485 (≠ R480), V486 (≠ S481)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ S264), R292 (≠ Y293)
- binding flavin-adenine dinucleotide: R161 (= R163), G222 (= G221), G223 (= G222), G224 (= G223), T246 (= T245), L247 (≠ V246), M248 (≠ N247), L264 (≠ S262), G286 (= G282), R288 (≠ E284), D290 (= D291), V293 (≠ A294), D310 (= D308), I311 (≠ L309), D329 (= D326), V330 (= V327), Q404 (≠ P394), M405 (≠ I395), G423 (≠ A414)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ E477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ D390), G401 (≠ S391), Q402 (≠ A392), H403 (≠ Q393), M428 (≠ L420), D453 (= D445), G454 (= G446), S455 (≠ G447), N480 (= N472), H482 (≠ E477), L483 (≠ I478), G484 (≠ A479), M485 (≠ R480), V486 (≠ S481)
Sites not aligning to the query:
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
27% identity, 98% coverage: 10:547/551 of query aligns to 9:560/595 of 1t9bB
- active site: Y29 (≠ I30), G31 (= G32), G32 (≠ V33), A33 (≠ H34), I34 (≠ T35), E55 (= E55), T78 (≠ I78), F117 (≠ H120), Q118 (≠ E121), E119 (≠ L122), K167 (≠ L173), R226 (vs. gap), M262 (≠ S262), V289 (≠ A294), V405 (≠ Y401), L430 (≠ Y417), G431 (= G418), M433 (≠ L420), D458 (= D445), N485 (= N472), E487 (≠ Y475), Q488 (= Q476), M490 (≠ I478), V491 (≠ A479), W494 (≠ M482), L516 (≠ T502), G521 (= G507), L522 (≠ I508), K555 (= K542)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (≠ N107), P108 (≠ E108), D287 (≠ M292), R288 (≠ Y293), M490 (≠ I478), W494 (≠ M482)
- binding flavin-adenine dinucleotide: R157 (= R163), G215 (= G221), A216 (≠ G222), G217 (= G223), N220 (≠ F226), T242 (= T245), L243 (≠ V246), Q244 (≠ N247), M259 (≠ V259), L260 (≠ P260), M262 (≠ S262), H263 (≠ P263), G282 (= G282), A283 (≠ T283), R284 (≠ E284), D286 (= D291), R288 (≠ Y293), V289 (≠ A294), E315 (≠ D308), V316 (≠ L309), N320 (≠ Q313), G333 (= G325), D334 (= D326), A335 (≠ V327), Q409 (≠ D405), M410 (vs. gap), G428 (vs. gap), G429 (= G416)
- binding magnesium ion: D458 (= D445), N485 (= N472), E487 (≠ Y475)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 15:487/582 of 3ea4A
- active site: Y32 (≠ I30), G34 (= G32), G35 (≠ V33), A36 (≠ H34), S37 (≠ T35), E58 (= E55), T81 (≠ I78), F120 (≠ L119), Q121 (≠ H120), E122 (= E121), K170 (≠ L173), M265 (≠ S264), V292 (≠ A294), V399 (≠ D390), G425 (= G418), M427 (≠ L420), D452 (= D445), N479 (= N472), H481 (≠ E477), L482 (≠ I478), M484 (≠ R480), V485 (≠ S481)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (≠ M292), R291 (≠ Y293)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R163), G221 (= G221), G222 (= G222), G223 (= G223), T245 (= T245), L246 (≠ V246), M247 (≠ N247), L263 (≠ S262), G264 (≠ P263), M265 (≠ S264), H266 (≠ L265), G285 (= G282), R287 (≠ E284), D289 (= D291), R291 (≠ Y293), D309 (= D308), I310 (≠ L309), G327 (= G325), D328 (= D326), V329 (= V327), M404 (≠ I395), G422 (≠ A414)
- binding magnesium ion: D452 (= D445), N479 (= N472), H481 (≠ E477)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ D390), G400 (≠ S391), Q401 (≠ A392), H402 (≠ Q393), M427 (≠ L420), G451 (= G444), D452 (= D445), G453 (= G446), S454 (≠ G447), N479 (= N472), H481 (≠ E477), L482 (≠ I478), G483 (≠ A479), M484 (≠ R480), V485 (≠ S481)
Sites not aligning to the query:
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
29% identity, 85% coverage: 13:483/551 of query aligns to 15:487/582 of 3e9yA
- active site: Y32 (≠ I30), G34 (= G32), G35 (≠ V33), A36 (≠ H34), S37 (≠ T35), E58 (= E55), T81 (≠ I78), F120 (≠ L119), Q121 (≠ H120), E122 (= E121), K170 (≠ L173), M265 (≠ S264), V292 (≠ A294), V399 (≠ D390), G425 (= G418), M427 (≠ L420), D452 (= D445), N479 (= N472), H481 (≠ E477), L482 (≠ I478), M484 (≠ R480), V485 (≠ S481)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (≠ M292), R291 (≠ Y293)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R163), G221 (= G221), G222 (= G222), G223 (= G223), T245 (= T245), L246 (≠ V246), M247 (≠ N247), L263 (≠ S262), G285 (= G282), R287 (≠ E284), D289 (= D291), R291 (≠ Y293), D309 (= D308), I310 (≠ L309), G327 (= G325), D328 (= D326), V329 (= V327), M404 (≠ I395), G422 (≠ A414)
- binding magnesium ion: D452 (= D445), N479 (= N472), H481 (≠ E477)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ D390), G400 (≠ S391), Q401 (≠ A392), H402 (≠ Q393), M427 (≠ L420), G451 (= G444), G453 (= G446), S454 (≠ G447), N479 (= N472), H481 (≠ E477), L482 (≠ I478), G483 (≠ A479), M484 (≠ R480), V485 (≠ S481)
Sites not aligning to the query:
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
26% identity, 98% coverage: 10:547/551 of query aligns to 13:572/607 of 6u9dB
- active site: Y33 (≠ I30), G35 (= G32), G36 (≠ V33), A37 (≠ H34), I38 (≠ T35), E59 (= E55), T82 (≠ I78), F121 (≠ H120), Q122 (≠ E121), E123 (≠ L122), K171 (≠ L173), M274 (≠ S262), V301 (≠ A294), V417 (≠ Y401), G443 (= G418), M445 (≠ L420), D470 (= D445), N497 (= N472), E499 (≠ Y475), Q500 (= Q476), M502 (≠ I478), V503 (≠ A479), W506 (≠ M482)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (≠ V33), V111 (≠ N107), P112 (≠ E108), F121 (≠ H120), K171 (≠ L173), D299 (≠ M292), R300 (≠ Y293), M502 (≠ I478), W506 (≠ M482)
- binding flavin-adenine dinucleotide: R161 (= R163), A228 (≠ G222), G229 (= G223), N232 (≠ F226), T254 (= T245), L255 (≠ V246), Q256 (≠ N247), L272 (≠ P260), M274 (≠ S262), G294 (= G282), R296 (≠ E284), D298 (= D291), R300 (≠ Y293), V301 (≠ A294), E327 (≠ D308), V328 (≠ L309), N332 (≠ Q313), D346 (= D326), A347 (≠ V327), M422 (vs. gap), G440 (vs. gap), G441 (= G416)
- binding magnesium ion: D470 (= D445), N497 (= N472)
- binding thiamine diphosphate: E59 (= E55), P85 (= P81), V417 (≠ Y401), G418 (≠ Y402), Q419 (≠ D403), H420 (= H404), G443 (= G418), M445 (≠ L420), A471 (≠ G446), S472 (≠ G447), N497 (= N472), E499 (≠ Y475), Q500 (= Q476), G501 (≠ E477), M502 (≠ I478), V503 (≠ A479)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 98% coverage: 10:547/551 of query aligns to 93:652/687 of P07342
- R241 (= R163) binding
- 355:376 (vs. 263:284, 18% identical) binding
- 407:426 (vs. 308:326, 15% identical) binding
Query Sequence
>GFF3828 FitnessBrowser__Phaeo:GFF3828
MGDHKTAAPTVGEALVEELAARGVQHVFGIPGVHTVELYRGLGRSDLRHITPRHEQGAGF
MADGYARVSGRPGVAFVITGPGLTNTLTPMAQARADSVPMLVVSGVNESGSLGHGMGHLH
ELPDQHALAKMVALKSEHVAAPEQLTPALDQAFAPIAGAALSRPGPTHVQIPLDVAGSAA
RDGDGQESAPTGEQDRTVSPADLAALMQRLTAAERPVILAGGGARFCADQLRQLAEYLGA
PVVQTVNARGVMFDHPLSVPASPSLGSVRELIEAADMVLALGTELGPTDYDMYATGTMPQ
MPGLIRIDLCADQLARHRAELTVQGDVAAVLSAALAEWKPDVRSTTDWGIGLAEQTRTAA
WDEIGESYRAQVMVLNALRAAVPGAIVVGDSAQPIYAGNLYYDHDRPGGWFNAATGYGAL
GYGIPAAIGAAVAAPETPVICITGDGGAQFSLPEIMTAVDEALSITFIVWNNHGYQEIAR
SMQDVGVPVVGCDPTPPDFAATARSFGISHRAVSADPQEVAVALHSAATETGPRMIEITT
PKFLPTLATKD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory