Comparing GFF3833 PGA1_262p02370 putative histidine transport system permease protein HisQ to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
33% identity, 88% coverage: 19:239/250 of query aligns to 6:215/215 of 4ymtC
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
33% identity, 87% coverage: 19:236/250 of query aligns to 6:212/214 of 4ymwC
>GFF3833 PGA1_262p02370 putative histidine transport system permease protein HisQ
MTGLLDLFGLAESAQLLSLSPPGWGGNLLRGLANSLQIALGAFGMGLIIGLFGAYGKLYG
GPILRDLLAIYTTVIRAVPELVLILILYYVGTDLINKVAGSLGYGRVEISGIVAGIWVLG
IVQGAYATEVLRGAIKAVPPGQIEAARSYGMPPFMTMRRVTIPAMMSFATPGLANLWLIA
TKDTALLAIVGFAELTLETRQAASSTRAYFTFFLAAGALYLMITLCSSVIFGWIERWARR
GQPSLRERRQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory