SitesBLAST
Comparing GFF3846 FitnessBrowser__Phaeo:GFF3846 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
41% identity, 98% coverage: 5:393/396 of query aligns to 2:396/396 of 1gvhA
- binding flavin-adenine dinucleotide: S46 (= S48), Q48 (= Q50), N50 (≠ D53), Y188 (= Y193), R204 (= R208), Q205 (≠ N209), Y206 (= Y210), S207 (= S211), A220 (≠ S224), V221 (= V225), E224 (= E228), G227 (= G231), Q228 (≠ V232), V229 (≠ I233), S230 (= S234), V269 (= V273), T272 (= T276), E388 (= E385), F390 (= F387)
- binding protoporphyrin ix containing fe: F43 (= F45), Q53 (= Q56), A56 (= A59), L57 (= L60), A60 (= A63), I61 (= I64), I81 (= I84), K84 (= K87), H85 (= H88), I90 (= I93), Q94 (≠ H97), Y95 (= Y98), L127 (= L132), F131 (≠ L136), H393 (≠ A390)
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 98% coverage: 5:393/396 of query aligns to 2:396/396 of P24232
- Y29 (= Y32) mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; mutation to F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- Y95 (= Y98) active site, Charge relay system
- E135 (= E140) active site, Charge relay system
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
40% identity, 97% coverage: 5:389/396 of query aligns to 2:398/403 of 1cqxA
- binding flavin-adenine dinucleotide: A46 (≠ S48), H47 (= H49), Y190 (= Y193), R206 (= R208), Q207 (≠ N209), Y208 (= Y210), S209 (= S211), S222 (= S224), E226 (= E228), Q231 (vs. gap), P232 (= P229), G234 (= G231), Y235 (≠ V232), V236 (≠ I233), S237 (= S234), V395 (≠ F386), G397 (= G388), P398 (= P389)
- binding protoporphyrin ix containing fe: F43 (= F45), N44 (= N46), I81 (= I84), H85 (= H88), L88 (= L91), V90 (≠ I93), Q94 (≠ H97), Y95 (= Y98), V98 (= V101), Y126 (= Y129), L129 (= L132), A130 (= A133), L133 (= L136)
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
40% identity, 97% coverage: 5:389/396 of query aligns to 2:398/403 of 3ozwA
- binding flavin-adenine dinucleotide: A46 (≠ S48), Q50 (≠ G52), R206 (= R208), Q207 (≠ N209), Y208 (= Y210), S209 (= S211), S222 (= S224), V223 (= V225), K224 (= K226), E226 (= E228), P232 (= P229), G234 (= G231), Y235 (≠ V232), V236 (≠ I233), S237 (= S234), V276 (= V273), T279 (= T276), V395 (≠ F386), F396 (= F387)
- binding protoporphyrin ix containing fe: V42 (≠ L44), F43 (= F45), I81 (= I84), H85 (= H88), L88 (= L91), V90 (≠ I93), Q94 (≠ H97), Y95 (= Y98), V98 (= V101), Y126 (= Y129), A130 (= A133), L133 (= L136)
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: Q53 (≠ S55), A56 (= A59), L102 (= L105), P398 (= P389)
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
40% identity, 97% coverage: 5:389/396 of query aligns to 2:398/403 of 3ozvA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: I24 (= I27), F28 (≠ M31), L57 (= L60), L102 (= L105), I106 (= I109)
- binding flavin-adenine dinucleotide: N44 (= N46), A46 (≠ S48), Q48 (= Q50), R206 (= R208), Q207 (≠ N209), Y208 (= Y210), S209 (= S211), S222 (= S224), V223 (= V225), K224 (= K226), E226 (= E228), P232 (= P229), G234 (= G231), Y235 (≠ V232), V236 (≠ I233), S237 (= S234), V276 (= V273), T279 (= T276), F396 (= F387)
- binding protoporphyrin ix containing fe: F43 (= F45), I81 (= I84), K84 (= K87), H85 (= H88), L88 (= L91), V90 (≠ I93), Q94 (≠ H97), Y95 (= Y98), V98 (= V101), Y126 (= Y129), A130 (= A133), L133 (= L136)
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
40% identity, 97% coverage: 5:389/396 of query aligns to 2:398/403 of 3ozuA
- binding flavin-adenine dinucleotide: A46 (≠ S48), H47 (= H49), R206 (= R208), Q207 (≠ N209), Y208 (= Y210), S209 (= S211), S222 (= S224), V223 (= V225), K224 (= K226), E226 (= E228), P232 (= P229), G234 (= G231), Y235 (≠ V232), V236 (≠ I233), S237 (= S234), E394 (= E385), V395 (≠ F386), G397 (= G388), P398 (= P389)
- binding protoporphyrin ix containing fe: F43 (= F45), N44 (= N46), I81 (= I84), H85 (= H88), L88 (= L91), V90 (≠ I93), Q94 (≠ H97), Y95 (= Y98), V98 (= V101), Y126 (= Y129), L129 (= L132), A130 (= A133), L133 (= L136)
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: I25 (≠ V28), F28 (≠ M31), F43 (= F45), A56 (= A59), L57 (= L60), L102 (= L105), W122 (= W125), A125 (= A128), Y126 (= Y129)
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
40% identity, 97% coverage: 5:389/396 of query aligns to 2:398/403 of P39662
- A60 (= A63) mutation to Y: Does not affect phospholipid-binding.
- V98 (= V101) mutation to F: Blocks phospholipid-binding.
4g1bA X-ray structure of yeast flavohemoglobin in complex with econazole (see paper)
35% identity, 97% coverage: 5:389/396 of query aligns to 2:392/398 of 4g1bA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: F28 (≠ M31), Y29 (= Y32), A56 (= A59), L57 (= L60), T60 (≠ A63), L102 (= L105), Y126 (= Y129)
- binding flavin-adenine dinucleotide: T46 (≠ S48), V50 (≠ G52), K84 (= K87), Y189 (= Y193), R207 (= R208), H208 (≠ N209), Y209 (= Y210), S210 (= S211), A223 (≠ S224), K225 (= K226), E227 (= E228), F233 (vs. gap), P234 (= P229), G236 (= G231), L237 (≠ V232), V238 (≠ I233), S239 (= S234), V282 (= V273), F390 (= F387)
- binding protoporphyrin ix containing fe: I42 (≠ L44), F43 (= F45), N44 (= N46), N47 (≠ H49), T60 (≠ A63), Q80 (≠ R83), I81 (= I84), K84 (= K87), H85 (= H88), L88 (= L91), I90 (= I93), H94 (= H97), Y95 (= Y98), V98 (= V101), F133 (≠ L136), P392 (= P389)
Sites not aligning to the query:
Q03331 Flavohemoprotein; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Candida norvegensis (Yeast) (Candida mycoderma) (see paper)
28% identity, 98% coverage: 4:391/396 of query aligns to 12:387/390 of Q03331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
40% identity, 59% coverage: 158:389/396 of query aligns to 4:237/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (= Y193), R55 (= R208), Q56 (≠ N209), Y57 (= Y210), S58 (= S211), S71 (= S224), V72 (= V225), E75 (= E228), N81 (≠ P229), G83 (= G231), L84 (≠ V232), V85 (≠ I233), S86 (= S234), T127 (= T276), E233 (= E385), F235 (= F387)
6o0aA Crystal structure of flavohemoglobin from malassezia yamatoensis with bound fad and heme determined by iron sad phasing (see paper)
30% identity, 97% coverage: 5:388/396 of query aligns to 3:383/383 of 6o0aA
- binding flavin-adenine dinucleotide: S48 (= S48), R51 (≠ Q51), D52 (= D53), Y190 (= Y193), R205 (= R208), Q206 (≠ N209), F207 (≠ Y210), T208 (≠ S211), K222 (= K226), D224 (≠ E228), H226 (≠ G230), G227 (= G231), E228 (≠ V232), M229 (≠ I233), T230 (≠ S234), T274 (= T276), E380 (= E385), F382 (= F387), G383 (= G388)
- binding protoporphyrin ix containing fe: M44 (≠ L44), F45 (= F45), S46 (≠ N46), L59 (= L60), S62 (≠ A63), R84 (= R83), V85 (≠ I84), H89 (= H88), L92 (= L91), L94 (≠ I93), E98 (≠ H97), Y99 (= Y98), V102 (= V101), Y130 (= Y129), L133 (= L132)
7dihA Crystal structure of thermoglobin y29f mutant in complex with imidazole
42% identity, 36% coverage: 5:146/396 of query aligns to 2:138/139 of 7dihA
- binding protoporphyrin ix containing fe: L42 (= L44), F43 (= F45), A46 (≠ S48), S47 (≠ H49), Q50 (= Q56), L54 (= L60), I78 (= I84), S81 (≠ K87), H82 (= H88), V87 (≠ I93), H91 (= H97), Y92 (= Y98), V95 (= V101), Y121 (= Y129), L124 (= L132)
3tm9A Y29a mutant of vitreoscilla stercoraria hemoglobin (see paper)
38% identity, 35% coverage: 5:144/396 of query aligns to 2:141/146 of 3tm9A
- binding protoporphyrin ix containing fe: L42 (= L44), F43 (= F45), Q53 (= Q56), L57 (= L60), T60 (≠ A63), I81 (= I84), K84 (= K87), H85 (= H88), V90 (≠ I93), Y95 (= Y98), V98 (= V101), Y126 (= Y129), F133 (≠ L136)
6wk3D Engineered carbene transferase rmanod q52v, putative nitric oxide dioxygenase from rhodothermus marinus (see paper)
41% identity, 38% coverage: 1:149/396 of query aligns to 2:146/146 of 6wk3D
- binding copper (ii) ion: E51 (≠ H49), H55 (≠ D53)
- binding protoporphyrin ix containing fe: L46 (= L44), F47 (= F45), L57 (= L60), R80 (= R83), M81 (≠ I84), S84 (≠ K87), H85 (= H88), R87 (≠ S90), A88 (≠ L91), V90 (≠ I93), H94 (= H97), Y95 (= Y98), V98 (= V101), Y126 (= Y129)
4vhbA Thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
38% identity, 35% coverage: 5:144/396 of query aligns to 2:133/138 of 4vhbA
- binding protoporphyrin ix containing fe: L42 (= L44), F43 (= F45), L49 (= L60), T52 (≠ A63), I73 (= I84), K76 (= K87), H77 (= H88), V82 (≠ I93), H86 (= H97), Y87 (= Y98), V90 (= V101), F125 (≠ L136)
- binding thiocyanate ion: F28 (≠ M31), L49 (= L60)
3vhbA Imidazole adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
38% identity, 35% coverage: 5:144/396 of query aligns to 1:131/135 of 3vhbA
- binding protoporphyrin ix containing fe: F42 (= F45), L47 (= L60), T50 (≠ A63), I71 (= I84), K74 (= K87), H75 (= H88), V80 (≠ I93), H84 (= H97), Y85 (= Y98), V88 (= V101), Y116 (= Y129), F123 (≠ L136)
- binding imidazole: Y28 (= Y32), L47 (= L60)
2wy4A Structure of bacterial globin from campylobacter jejuni at 1.35 a resolution (see paper)
35% identity, 35% coverage: 6:145/396 of query aligns to 1:138/139 of 2wy4A
- binding protoporphyrin ix containing fe: M40 (≠ L44), F41 (= F45), N42 (= N46), Q51 (= Q56), L55 (= L60), A58 (= A63), V79 (≠ I84), T82 (≠ K87), H83 (= H88), L86 (= L91), V88 (≠ I93), H92 (= H97), Y93 (= Y98), V96 (= V101), Y129 (≠ L136)
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
28% identity, 58% coverage: 162:390/396 of query aligns to 15:247/250 of 1tvcA
- active site: Y63 (= Y210), S64 (= S211), L215 (≠ I358)
- binding dihydroflavine-adenine dinucleotide: N24 (≠ S171), F49 (≠ Y193), R61 (= R208), S62 (≠ N209), Y63 (= Y210), S64 (= S211), L78 (≠ S224), I79 (≠ V225), R80 (≠ K226), L82 (≠ E228), F87 (≠ I233), G128 (= G274), N155 (≠ A298), E159 (≠ D302), S186 (≠ A331), G187 (≠ A332), E242 (= E385), F244 (= F387), L245 (≠ G388)
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
27% identity, 55% coverage: 169:387/396 of query aligns to 119:334/337 of 1krhA
- active site: C306 (= C359)
- binding flavin-adenine dinucleotide: Y143 (= Y193), R155 (= R207), S156 (≠ N209), Y157 (= Y210), S158 (= S211), V171 (≠ S224), V172 (= V225), G178 (= G231), K179 (≠ V232), M180 (≠ I233), S181 (= S234), T219 (≠ V273), E332 (= E385), F334 (= F387)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 335, 336, 337
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 41, 43, 45, 46, 48, 82
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
28% identity, 52% coverage: 186:390/396 of query aligns to 125:332/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y193), R144 (= R208), Q145 (≠ N209), Y146 (= Y210), S147 (= S211), H161 (≠ S224), V162 (= V225), V165 (≠ E228), G168 (= G231), V169 (= V232), A170 (≠ I233), T171 (≠ S234), T214 (≠ V273), F329 (= F387), P331 (= P389)
Sites not aligning to the query:
Query Sequence
>GFF3846 FitnessBrowser__Phaeo:GFF3846
MAQPLSEQSKAIVTATVPALEAHGGAIVAEMYTRLLADEDIKALFNQSHQQGDSSQHAAL
ANAILGYARNIDNLGALSSVVERIVNKHVSLQIKPEHYTHVATALLGAIEAVLGQAASPE
VLEAWGEAYWFLANLLIEAERKMYDDIANAEGGWNGWREFVIVGIIGESASVKSFVLRPV
DGGPVLRHQPGQYLAFDFDHPDTGKARRNYSISCAPNGEYYRISVKREPGGVISGWLHEV
ATEGTVLRVAAPAGDFVLKDRPEGEVVLLSAGVGLTPMVAMLETLAANDRSATYLHAAVD
GDNLAMEGLSKSLAKRSVIFLETPSDADRAAARYDVEGRITPDWLAANTNTALSDYYICG
PKGFMAMAIAGLRAANVDMDRIHFEFFGPAEDLGVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory