Comparing GFF385 FitnessBrowser__Phaeo:GFF385 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
34% identity, 99% coverage: 6:507/509 of query aligns to 5:494/501 of P04983
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 50% coverage: 6:261/509 of query aligns to 2:272/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 50% coverage: 6:261/509 of query aligns to 3:273/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 50% coverage: 6:261/509 of query aligns to 3:273/344 of 3tuiC
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 43% coverage: 2:221/509 of query aligns to 1:230/253 of 1g9xB
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 50% coverage: 6:261/509 of query aligns to 3:273/344 of 6cvlD
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 45% coverage: 6:233/509 of query aligns to 2:223/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 43% coverage: 4:220/509 of query aligns to 1:215/241 of 4u00A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 43% coverage: 2:221/509 of query aligns to 1:230/254 of 1g6hA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
31% identity, 45% coverage: 6:235/509 of query aligns to 4:241/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
31% identity, 45% coverage: 6:235/509 of query aligns to 4:241/592 of 5lj7A
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 42% coverage: 6:217/509 of query aligns to 4:214/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 42% coverage: 6:217/509 of query aligns to 4:214/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 42% coverage: 6:217/509 of query aligns to 4:214/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 42% coverage: 6:217/509 of query aligns to 4:214/242 of 2oljA
Q8R420 Phospholipid-transporting ATPase ABCA3; ATP-binding cassette sub-family A member 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Mus musculus (Mouse) (see paper)
30% identity, 43% coverage: 6:222/509 of query aligns to 530:744/1704 of Q8R420
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
32% identity, 38% coverage: 6:199/509 of query aligns to 4:197/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
32% identity, 38% coverage: 6:199/509 of query aligns to 4:197/229 of 6z67B
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
33% identity, 42% coverage: 6:221/509 of query aligns to 4:222/226 of 5xu1B
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 39% coverage: 3:199/509 of query aligns to 2:202/648 of P75831
>GFF385 FitnessBrowser__Phaeo:GFF385
MTAPAIELKGISKAFGPVQANKDISIRVAPGTIHGIIGENGAGKSTLMSILYGFYKADKG
EVWIHGKRTEIPDSQAAISAGIGMVFQHFKLVENFTVLENIILGAEDGGLLKPSLSKARK
SLKDLAAEYELNVDPDARIDEIGVGMQQRVEILKALYRQADILILDEPTGVLTPAEADQL
FRILDRLRAEGKTIILITHKLREIMEYTDTVSVMRRGEMTATVKTAETSPEHLAELMVGR
KVLLRVDKVPATPGKPILEIENLSVVDEAGVARVKNIDLTVRAGEILGIAGVAGNGQSEL
MEVLGGMREGQGSIRLNGAPLPLSGAGSDARARRAAHVAHVPEDRQREGLIMDFHAWENV
AFGYHHAPEYQRGLLMNNAALRADTEAKMAKFDVRPPDPWLAAKNFSGGNQQKIVVAREI
ERNPELLLIGQPTRGVDIGAIEFIHKQIVELRDQGKAILLVSVELEEILSLADRVAVMFD
GMIMGERPADQTDEKELGLLMAGVAGEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory