Comparing GFF3852 FitnessBrowser__Phaeo:GFF3852 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
8hqqA Crystal structure of the glucose-binding protein sar11_0769 from "candidatus pelagibacter ubique" htcc1062 bound to glucose
35% identity, 91% coverage: 25:396/409 of query aligns to 6:385/398 of 8hqqA
5dvjA Crystal structure of galactose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
37% identity, 89% coverage: 24:387/409 of query aligns to 5:373/396 of 5dvjA
5dviA High resolution crystal structure of glucose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
37% identity, 89% coverage: 24:387/409 of query aligns to 5:373/396 of 5dviA
4r2bA Crystal structure of sugar transporter oant_3817 from ochrobactrum anthropi, target efi-510528, with bound glucose
34% identity, 92% coverage: 23:397/409 of query aligns to 6:383/395 of 4r2bA
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
31% identity, 80% coverage: 24:349/409 of query aligns to 3:327/392 of 2b3fA
Sites not aligning to the query:
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
31% identity, 80% coverage: 24:349/409 of query aligns to 3:327/392 of 2b3bC
Sites not aligning to the query:
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
31% identity, 80% coverage: 24:349/409 of query aligns to 3:327/392 of 2b3bA
Sites not aligning to the query:
7ehpA Chitin oligosaccharide binding protein (see paper)
21% identity, 81% coverage: 77:409/409 of query aligns to 58:393/397 of 7ehpA
Sites not aligning to the query:
4c1tA Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. Lactis bl-04 in complex with arabinoxylotriose (see paper)
24% identity, 69% coverage: 88:368/409 of query aligns to 69:352/396 of 4c1tA
Sites not aligning to the query:
4g68A Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus (see paper)
30% identity, 24% coverage: 88:185/409 of query aligns to 66:160/392 of 4g68A
Sites not aligning to the query:
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
24% identity, 57% coverage: 71:303/409 of query aligns to 49:281/390 of 3oo6A
Sites not aligning to the query:
>GFF3852 FitnessBrowser__Phaeo:GFF3852
MKLTSILMTTALSVSATIAQSADLEVTHWWTSGGEAAAVTKFADAVNGQTTHNWVDGAIA
GSGTTARPIIISRILGGDPMAATQLTHGRQAEELIEAGLMTDLTELAEQEGWRDIVNPPS
LLDSCTYEGRIYCVPVNIHSTQWLWLSHEAFDKAGMSVPQDWYEFVAAAPKLAEAGIVPL
AMGQQGWQQRIAFGALTVGLVDQDSWRKVSLERDAGVAAGPQYAKVFDAVVDARELARNS
NVQDWNLATNMVITGKAGGQIMGDWAQGEFTLAEQVAGQDYSCLPGMGLNQIIDTSGDAF
YFPVIDDAEVRQAQMDMASVLISKEVQVDFNLTKGSLPVRGDVDLSAANDCMKKGLAILA
DGNVLPSMDQAFSADTQAQIQDLMAEFWASDMAAADAQARYAEIIADAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory