Comparing GFF3853 FitnessBrowser__Phaeo:GFF3853 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
29% identity, 74% coverage: 66:295/310 of query aligns to 49:271/285 of 7cagA
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
25% identity, 65% coverage: 90:292/310 of query aligns to 270:483/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
25% identity, 65% coverage: 90:292/310 of query aligns to 285:498/514 of P02916
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
25% identity, 73% coverage: 33:258/310 of query aligns to 36:261/313 of P94529
>GFF3853 FitnessBrowser__Phaeo:GFF3853
MTPAPPTGRSGRSPTARPRPPRVLRNLNAKIASVPMILTALVVFMGGTAWTVAHSFTKSR
LLPKWKFVGFDQYERLWSSNRWLISVENLLIYGLCSLVLTMAIGFTLAALLDRKIRFEGA
FRTIFLYPFALSFVVTGLAWQWILNPDFGIQNVVRSWGWESFAFDPLNNPETVIFGVLIA
GLWQGSGFVMVIMLAGLRGIDEDIWKAARVDGIGVTKTYVRVIIPMMRPVFVTALVIIAS
GIIKLYDLVVAQTNGGPGISSEVPAKYVINYMFEAQNLGQGFAASTMMLLSVIIILVPWA
YLEFGGKKRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory