Comparing GFF3854 FitnessBrowser__Marino:GFF3854 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
32% identity, 94% coverage: 17:338/341 of query aligns to 5:324/330 of 7ug8B
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
31% identity, 92% coverage: 17:331/341 of query aligns to 5:317/344 of 4yicA
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
32% identity, 93% coverage: 14:331/341 of query aligns to 1:316/337 of 2hzlB
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
32% identity, 92% coverage: 17:331/341 of query aligns to 32:344/365 of Q3J1R2
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
32% identity, 92% coverage: 18:331/341 of query aligns to 4:316/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
30% identity, 94% coverage: 18:337/341 of query aligns to 5:326/329 of 4petA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
26% identity, 92% coverage: 14:326/341 of query aligns to 31:346/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
26% identity, 91% coverage: 18:326/341 of query aligns to 4:315/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
26% identity, 91% coverage: 18:326/341 of query aligns to 4:315/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
28% identity, 66% coverage: 40:264/341 of query aligns to 23:253/315 of 4pe3A
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
28% identity, 53% coverage: 18:198/341 of query aligns to 4:182/563 of 7e9yA
Sites not aligning to the query:
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
26% identity, 70% coverage: 21:259/341 of query aligns to 1:239/306 of 4xfeA
4pgpA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound 3-indole acetic acid (see paper)
23% identity, 80% coverage: 40:313/341 of query aligns to 24:289/308 of 4pgpA
Sites not aligning to the query:
4pgnA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound indole pyruvate (see paper)
23% identity, 80% coverage: 40:313/341 of query aligns to 24:289/308 of 4pgnA
Sites not aligning to the query:
4napD Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634), target efi-510102, with bound d-tryptophan (see paper)
23% identity, 80% coverage: 40:313/341 of query aligns to 24:289/310 of 4napD
Sites not aligning to the query:
4n6dA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638 (desal_3247), target efi-510112, phased with i3c, open complex, c-terminus of symmetry mate bound in ligand binding site (see paper)
26% identity, 57% coverage: 49:241/341 of query aligns to 34:217/319 of 4n6dA
Sites not aligning to the query:
4p56A Crystal structure of a trap periplasmic solute binding protein from bordetella bronchiseptica, target efi-510038 (bb2442), with bound (r)-mandelate and (s)-mandelate (see paper)
28% identity, 66% coverage: 41:266/341 of query aligns to 25:242/315 of 4p56A
Sites not aligning to the query:
4p56B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchiseptica, target efi-510038 (bb2442), with bound (r)-mandelate and (s)-mandelate (see paper)
28% identity, 66% coverage: 41:266/341 of query aligns to 26:243/317 of 4p56B
Sites not aligning to the query:
7nswBBB TRAP dicarboxylate transporter-DctP subunit (see paper)
24% identity, 83% coverage: 47:328/341 of query aligns to 35:321/328 of 7nswBBB
7ntdAAA TRAP dicarboxylate transporter-DctP subunit (see paper)
24% identity, 83% coverage: 47:328/341 of query aligns to 33:319/322 of 7ntdAAA
Sites not aligning to the query:
>GFF3854 FitnessBrowser__Marino:GFF3854
MAGAIALTTGSAFADDLRWKMPVAFATNLPGLGSPAAWVADNLTTASDGSIQVRVYEPGK
LVPPFDILQSVSDGKVSAGYTWIGYDQGKVPAIPLFAAVPFGMKPPAYIGWYYFGGGHEM
LQETYANKGFNVHAQLCGIIGPETAGWYSEPIETLEDYKGLKIRFAGLGGKVLEKLGASV
TMMPGGELYQALEKGTIDATEFSMPAIDQILGFNQVVKYNLFPGWHQQFTAQYMLINKDE
WARATEAQKALVEASCTAATTRGLAEGEYKNGKVLAEFQDKGVQADQIPRDVLLKLREVT
QEVLEEEASKDADFKRVYESQQEFMESYKIWDTRAYVPADL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory