Comparing GFF3854 FitnessBrowser__psRCH2:GFF3854 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
5a1sD Crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica. (see paper)
38% identity, 95% coverage: 18:434/437 of query aligns to 3:430/434 of 5a1sD
5x9rA Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
38% identity, 94% coverage: 23:431/437 of query aligns to 2:412/416 of 5x9rA
5xasB Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
37% identity, 95% coverage: 18:431/437 of query aligns to 2:402/407 of 5xasB
5xarD Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
37% identity, 95% coverage: 18:431/437 of query aligns to 5:406/411 of 5xarD
>GFF3854 FitnessBrowser__psRCH2:GFF3854
MNRTTLSPAVPEGTPNVSLLSQRIFNLPLPLFAIALLVMAAAIVTDTLPTGMIGALLVMM
LLGELLGFAGDRLPIIRTYLGGGAIMALFGAASMVYFGWLPAAVADDVASFMKGGGFLDF
YIAALITGSILGMDAKVLVKVGSRYALPLLCSVLFAALFAMAVGALLGFSPQDAVVVIAM
PIMGGGMGAGAVPMSQIYEQLLGQPASYYISILVPALALGNVFAIIIAGLLNGLGNRYPS
LTGNGQMMPGVDVSDKEGPITLPALGIGLVAALSFFIAGQILGKFVPLHPYALMIVLVAL
LKVSNLVPESINDAASQWFRFVARNWTFALLFGIGVAFTDLGQVLDAISLTYVLIVFAVV
AGAAFGAGLVGRLVGFYPIESAITAGLCMANMGGTGDVAVLSAARRMSLMPFAQISSRLG
GALILLISSVVVPLFFT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory