Comparing GFF3854 PGA1_78p00180 putative sn-glycerol-3-phosphate transport system permease protein UgpE to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
27% identity, 93% coverage: 24:309/309 of query aligns to 5:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
25% identity, 67% coverage: 104:309/309 of query aligns to 87:296/296 of P68183
>GFF3854 PGA1_78p00180 putative sn-glycerol-3-phosphate transport system permease protein UgpE
MVDLTPQTPKGSPVRILDGPRGAKPKTRVSRRNVMLYGTLLLIALYYLLPLYVMVVTSLK
GMPEIRLGNIFSPPVEITFQPWIKAWSEACTGINCDGLSRGFGNSIKILVPSVALSIAIA
SVNGYALANWRFKGSETFFTILIIGAFIPYQTMLYPIVIILRELKLMGSLWGLVLVHSIF
GMPILTLLFRNYFSSLPEELFKAARVDGAGFWGIYLRVMVPMSIPIFVVAMILQVTGIWN
DFLFGVIYTKPETYPMTVQLNNIVNSVQGVKEYNVNMAATLLTGLVPLVIYLVSGKLFVR
GIAAGAVKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory