SitesBLAST
Comparing GFF3858 FitnessBrowser__Marino:GFF3858 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wd1A Acetoacetyl-coa synthetase from streptomyces lividans (see paper)
44% identity, 98% coverage: 10:655/662 of query aligns to 4:642/646 of 4wd1A
P78773 Probable acetyl-coenzyme A synthetase; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 92% coverage: 40:650/662 of query aligns to 34:650/662 of P78773
- T596 (≠ G596) modified: Phosphothreonine
P52910 Acetyl-coenzyme A synthetase 2; Acetate--CoA ligase 2; Acyl-activating enzyme 2; EC 6.2.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 94% coverage: 32:650/662 of query aligns to 28:669/683 of P52910
- K506 (≠ N501) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7l4gB Crystal structure of acetyl-coa synthetase in complex with acetyl adenylate from cryptococcus neoformans h99
28% identity, 88% coverage: 76:655/662 of query aligns to 78:668/668 of 7l4gB
- active site: T280 (≠ S278), T432 (= T427), E433 (≠ D428), N539 (= N532), R544 (= R537), K631 (= K619)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] ethanoate: W325 (= W323), G403 (= G399), E404 (≠ S400), P405 (= P401), T428 (≠ I423), Y429 (≠ A424), W430 (≠ G425), M431 (≠ G426), T432 (= T427), D518 (= D511), I530 (= I523), R533 (= R526)
5u29A Crystal structure of cryptococcus neoformans h99 acetyl-coa synthetase in complex with ac-ams
28% identity, 88% coverage: 76:655/662 of query aligns to 78:668/668 of 5u29A
- active site: T280 (≠ S278), T432 (= T427), E433 (≠ D428), N539 (= N532), R544 (= R537), K631 (= K619)
- binding 5'-O-(acetylsulfamoyl)adenosine: W325 (= W323), G403 (= G399), E404 (≠ S400), P405 (= P401), T428 (≠ I423), Y429 (≠ A424), W430 (≠ G425), M431 (≠ G426), T432 (= T427), D518 (= D511), I530 (= I523), R533 (= R526)
7kdsA Crystal structure of acetyl-coa synthetase 2 in complex with adenosine-5'-propylphosphate from candida albicans
28% identity, 87% coverage: 83:658/662 of query aligns to 79:651/654 of 7kdsA
- active site: T275 (≠ S278), T427 (≠ I423), E428 (≠ A424), N534 (= N532), R539 (= R537), K620 (= K619)
- binding adenosine-5'-monophosphate-propyl ester: I321 (≠ M324), G398 (= G399), E399 (≠ S400), P400 (= P401), D422 (vs. gap), T423 (vs. gap), Y424 (vs. gap), W425 (vs. gap), Q426 (≠ S422), T427 (≠ I423), D513 (= D511), R528 (= R526), N534 (= N532), R539 (= R537)
8w0jA Acetyl-coenzyme A synthetase 2
28% identity, 87% coverage: 83:658/662 of query aligns to 80:657/662 of 8w0jA
- binding 5'-O-{(S)-hydroxy[(prop-2-yn-1-yl)oxy]phosphoryl}adenosine: G399 (= G399), E400 (≠ S400), P401 (= P401), T424 (vs. gap), Y425 (vs. gap), W426 (vs. gap), Q427 (≠ S422), T428 (≠ I423), D514 (= D511), I526 (= I523), R529 (= R526), R540 (= R537)
8w0dA Acetyl-coenzyme A synthetase 2
28% identity, 87% coverage: 83:658/662 of query aligns to 79:661/666 of 8w0dA
- binding 5'-O-{(R)-hydroxy[(propan-2-yl)oxy]phosphoryl}adenosine: G398 (= G399), E399 (≠ S400), P400 (= P401), T423 (vs. gap), Y424 (vs. gap), W425 (vs. gap), Q426 (vs. gap), T427 (≠ I423), D513 (= D511), I525 (= I523), R528 (= R526), R539 (= R537)
8v4rA Crystal structure of acetyl-coa synthetase 2 in complex with amp and coa from candida albicans
28% identity, 87% coverage: 83:658/662 of query aligns to 79:661/666 of 8v4rA
- binding adenosine monophosphate: G398 (= G399), E399 (≠ S400), P400 (= P401), T423 (vs. gap), Y424 (vs. gap), Q426 (vs. gap), T427 (≠ I423), D513 (= D511), I525 (= I523), R528 (= R526), R539 (= R537)
- binding coenzyme a: F175 (≠ S178), R203 (≠ Y206), R206 (≠ K209), G316 (≠ T319), H538 (≠ V536), R599 (= R594), F605 (≠ R600)
8v4pA Crystal structure of acetyl-coa synthetase 2 in complex with adenosine-5'-allylphosphate from candida albicans
28% identity, 87% coverage: 83:658/662 of query aligns to 79:656/660 of 8v4pA
- binding 5'-O-{(S)-hydroxy[(prop-2-en-1-yl)oxy]phosphoryl}adenosine: P152 (≠ T155), A176 (≠ P179), G177 (≠ D180), R203 (≠ Y206), T208 (≠ F211), D317 (≠ T320), E342 (≠ D343), G343 (= G344), P345 (= P346), G398 (= G399), E399 (≠ S400), P400 (= P401), T423 (vs. gap), W425 (vs. gap), Q426 (vs. gap), T427 (≠ I423), D513 (= D511), I525 (= I523), R528 (= R526), R539 (= R537)
8v4oA Crystal structure of acetyl-coa synthetase 2 in complex with amp from candida albicans
28% identity, 87% coverage: 83:658/662 of query aligns to 79:656/660 of 8v4oA
- binding adenosine monophosphate: G398 (= G399), E399 (≠ S400), P400 (= P401), T423 (vs. gap), Y424 (vs. gap), W425 (vs. gap), Q426 (vs. gap), T427 (≠ I423), D513 (= D511), I525 (= I523), R528 (= R526), R539 (= R537)
8w0cA Acetyl-coenzyme A synthetase 2
28% identity, 87% coverage: 83:658/662 of query aligns to 80:662/667 of 8w0cA
- binding 5'-O-[(S)-(cyclopentyloxy)(hydroxy)phosphoryl]adenosine: G399 (= G399), E400 (≠ S400), P401 (= P401), T424 (vs. gap), Y425 (vs. gap), W426 (vs. gap), Q427 (≠ S422), T428 (≠ I423), D514 (= D511), R529 (= R526), R540 (= R537)
8w0bA Acetyl-coenzyme A synthetase 2
28% identity, 87% coverage: 83:658/662 of query aligns to 80:662/667 of 8w0bA
- binding 5'-O-[(R)-(cyclopropyloxy)(hydroxy)phosphoryl]adenosine: V398 (≠ T398), G399 (= G399), E400 (≠ S400), P401 (= P401), T424 (vs. gap), Y425 (vs. gap), W426 (vs. gap), Q427 (≠ S422), T428 (≠ I423), D514 (= D511), I526 (= I523), R529 (= R526), R540 (= R537)
5k8fA Crystal structure of acetyl-coa synthetase in complex with atp and acetyl-amp from cryptococcus neoformans h99
28% identity, 88% coverage: 76:655/662 of query aligns to 78:656/656 of 5k8fA
- active site: T280 (≠ S278), T432 (= T427), E433 (≠ D428), N539 (= N532), R544 (= R537), K631 (= K619)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] ethanoate: W325 (= W323), I326 (≠ M324), G403 (= G399), E404 (≠ S400), P405 (= P401), T428 (≠ I423), Y429 (≠ A424), W430 (≠ G425), M431 (≠ G426), T432 (= T427), D518 (= D511), I530 (= I523), R533 (= R526), K631 (= K619)
- binding adenosine-5'-triphosphate: T280 (≠ S278), S281 (= S279), G282 (= G280), S283 (≠ T281), T284 (= T282), K288 (= K286), G403 (= G399), E404 (≠ S400), P405 (= P401), T428 (≠ I423), Y429 (≠ A424), M431 (≠ G426), T432 (= T427), D518 (= D511), I530 (= I523), R533 (= R526), K631 (= K619)
8g0vA Crystal structure of acetyl-coa synthetase in complex with a propyne ester amp inhibitor from cryptococcus neoformans h99
27% identity, 88% coverage: 76:655/662 of query aligns to 78:666/666 of 8g0vA
- binding 5'-O-{(S)-hydroxy[(prop-2-yn-1-yl)oxy]phosphoryl}adenosine: W323 (= W323), I324 (≠ M324), V400 (≠ T398), G401 (= G399), E402 (≠ S400), P403 (= P401), T426 (≠ I423), Y427 (≠ A424), W428 (≠ G425), M429 (≠ G426), T430 (= T427), D516 (= D511)
8g0uA Crystal structure of acetyl-coa synthetase in complex with an isopropyl ester amp inhibitor from cryptococcus neoformans h99
27% identity, 88% coverage: 76:655/662 of query aligns to 78:666/666 of 8g0uA
- binding 5'-O-{(R)-hydroxy[(propan-2-yl)oxy]phosphoryl}adenosine: W323 (= W323), I324 (≠ M324), G401 (= G399), E402 (≠ S400), P403 (= P401), T426 (≠ I423), Y427 (≠ A424), W428 (≠ G425), M429 (≠ G426), T430 (= T427), D516 (= D511), I528 (= I523), R531 (= R526)
7knoA Crystal structure of acetyl-coa synthetase in complex with adenosine- 5'-ethylphosphate from cryptococcus neoformans var. Grubii serotype a (h99)
27% identity, 88% coverage: 76:655/662 of query aligns to 78:666/666 of 7knoA
- active site: T280 (≠ S278), T430 (= T427), E431 (≠ D428), N537 (= N532), R542 (= R537), K629 (= K619)
- binding 5'-O-[(S)-ethoxy(hydroxy)phosphoryl]adenosine: W323 (= W323), I324 (≠ M324), G401 (= G399), E402 (≠ S400), P403 (= P401), T426 (≠ I423), Y427 (≠ A424), W428 (≠ G425), M429 (≠ G426), T430 (= T427), D516 (= D511), R531 (= R526)
8v5gA Crystal structure of acetyl-coa synthetase from cryptococcus neoformans h99 in complex with an ethylsulfamide amp inhibitor
27% identity, 87% coverage: 76:654/662 of query aligns to 77:655/655 of 8v5gA
- binding 5'-deoxy-5'-(ethylsulfamamido)adenosine: V401 (≠ T398), G402 (= G399), E403 (≠ S400), P404 (= P401), T427 (≠ I423), Y428 (≠ A424), W429 (≠ G425), M430 (≠ G426), D517 (= D511), I529 (= I523), K628 (= K619)
8g0tA Crystal structure of acetyl-coa synthetase in complex with a cyclopropyl ester amp inhibitor from cryptococcus neoformans h99
27% identity, 88% coverage: 76:655/662 of query aligns to 77:656/656 of 8g0tA
- binding 5'-O-[(R)-(cyclopropyloxy)(hydroxy)phosphoryl]adenosine: W321 (= W323), I322 (≠ M324), G399 (= G399), E400 (≠ S400), P401 (= P401), D423 (≠ S422), T424 (≠ I423), Y425 (≠ A424), W426 (≠ G425), M427 (≠ G426), T428 (= T427), D514 (= D511), R529 (= R526), K627 (= K619)
7knpA Crystal structure of acetyl-coa synthetase in complex with adenosine- 5'-butylphosphate from cryptococcus neoformans var. Grubii serotype a (h99)
28% identity, 84% coverage: 76:631/662 of query aligns to 78:641/653 of 7knpA
- active site: T280 (≠ S278), T430 (= T427), E431 (≠ D428), N537 (= N532), R542 (= R537), K629 (= K619)
- binding 5'-O-[(S)-butoxy(hydroxy)phosphoryl]adenosine: T325 (≠ M325), V400 (≠ T398), G401 (= G399), E402 (≠ S400), P403 (= P401), T426 (≠ I423), Y427 (≠ A424), W428 (≠ G425), M429 (≠ G426), T430 (= T427), D516 (= D511), I528 (= I523), R531 (= R526)
Query Sequence
>GFF3858 FitnessBrowser__Marino:GFF3858
MSNEEQSPVVWSPSEDTLANSRMGQFKAWLEQQGFGPFADYHALHQWSIDELETFWQKVW
DYCGLVCDTPAEKVLGKHEMPGAEWFPGMKLNFAANLLRLADGEHRDREAVVAYCETRPV
LRRTYAELKADAGALEAFLRSKGIKQGDRVAGVVTNGYEALVGMLAATSLGAIWSSASPD
FGIGAILDRFGQIEPSALIVVNGYGYGGKVFARQQDFAELIAGLPTLKAVVSVQQLPDEA
PISGDLVTTWENALAAGEGTAPSFTPLPPDHPVYILYSSGTTGKPKCIVHGNAGLLVNHA
KELMLHGDVGPEDRFLYFTTCGWMMWNWQASALMTGAAVITVDGSPGYPSLNFLWDTVAE
EKVTHFGTSARFIAGCRKGELKPAKTLDQSKLRVVFSTGSPLLPEDYDWVYSDGAPDALL
GSIAGGTDICGCFVGSTPLLPVRRGEIQCRFLGVDAVAYGDDGQPVSEGRGELVCRQPLP
SMPVSFWQDPDGERYRDAYFNTFPGVWAHGDFIEFTEHGGAIIYGRSDATLNPGGVRIGT
AEIYRQVETVAEVKDSLVVGRQIDGDVEVVLLVVPADGQEITDDLLKQLKSRIREGASPR
HVPKHIVEVNDIPYTRSGKKVELAVARLINGSKKADNRDALGNPEALDHIRERLSAVGLL
PE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory