SitesBLAST
Comparing GFF3871 FitnessBrowser__Phaeo:GFF3871 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
24% identity, 90% coverage: 29:427/445 of query aligns to 39:435/866 of Q9UI17
- CV 59:60 (≠ YT 49:50) binding
- EK 80:81 (≠ DA 69:70) binding
- 87:95 (vs. 76:84, 33% identical) binding
- H91 (≠ R80) modified: Tele-8alpha-FAD histidine
- H109 (≠ E113) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V222) binding
- S279 (= S280) to P: in dbSNP:rs532964
- F-GYGII 397:402 (≠ YHGSGVC 384:390) binding
Sites not aligning to the query:
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
21% identity, 62% coverage: 129:406/445 of query aligns to 86:349/369 of O31616
- V174 (= V222) binding
- H244 (≠ Y304) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ I359) binding
- 327:333 (vs. 384:390, 14% identical) binding
- R329 (≠ G386) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
21% identity, 62% coverage: 129:406/445 of query aligns to 86:349/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (= P221), V174 (= V222), S202 (≠ T250), G203 (≠ N251), W205 (≠ Y253), F209 (≠ D257), G300 (= G357), R302 (≠ I359), H327 (≠ Y384), F328 (≠ H385), R329 (≠ G386), N330 (≠ S387), G331 (= G388), I332 (≠ V389)
- binding glycolic acid: Y246 (= Y304), R302 (≠ I359), R329 (≠ G386)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
21% identity, 63% coverage: 128:406/445 of query aligns to 85:349/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ R306), R302 (≠ I359), R329 (≠ G386)
- binding flavin-adenine dinucleotide: V174 (= V222), S202 (≠ T250), G203 (≠ N251), W205 (≠ Y253), F209 (≠ D257), G300 (= G357), R302 (≠ I359), H327 (≠ Y384), R329 (≠ G386), N330 (≠ S387), G331 (= G388), I332 (≠ V389)
- binding phosphate ion: R89 (≠ D132), R254 (= R312)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
24% identity, 47% coverage: 196:406/445 of query aligns to 148:349/369 of S5FMM4
- S202 (≠ T250) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ V389) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ I399) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
Query Sequence
>GFF3871 FitnessBrowser__Phaeo:GFF3871
MRRIYEPLAYTDRPIRARYWDRFLPDPAPCYAPLQDEVTAEFAVIGGGYTGLSAALTLAE
AGADVVLLDAQRPGWGASGRNGGLVSVGSAKLADDAILRRYGQADAEQFFAAERAAVDLV
ETYVERLALEVDRHSRGYTFVAHRPDRLTELHDYGQEYTRRYGLSYEFIPKEEMAAHGLN
SPEFHGAVNLPVGFALNPMKFVLGLTRAVEAAGVRMFSDTPVQAITPAAGGYLLQGPAGQ
VRARHLLIATNGYSSDDLPQALAGRYLPVQSNIMVTRPLSEAEIADQGWWSEQMVCDSRT
LLHYLRLLPDRRLLLGLRGSVRVSEENIAVTKARARADFDRMFPAWRAVETAHFWSGLIC
MTRNLVPFAGAIPGMKNAWAALGYHGSGVCMAPYAGALIADQALGRHQRPHPDLMQRPLR
RFELGRWRRLSLPLAFGWYHIKDRI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory