Comparing GFF3890 FitnessBrowser__psRCH2:GFF3890 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2p3nA Thermotoga maritima impase tm1415 (see paper)
28% identity, 85% coverage: 6:236/272 of query aligns to 4:221/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 85% coverage: 6:236/272 of query aligns to 4:221/256 of O33832
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
27% identity, 86% coverage: 10:244/272 of query aligns to 13:248/277 of P20456
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
27% identity, 86% coverage: 10:244/272 of query aligns to 11:246/274 of 2bjiA
6giuA Human impase with l-690330 (see paper)
27% identity, 86% coverage: 10:244/272 of query aligns to 11:246/275 of 6giuA
6zk0AAA human impase with ebselen (see paper)
27% identity, 86% coverage: 10:244/272 of query aligns to 10:245/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
27% identity, 86% coverage: 10:244/272 of query aligns to 11:246/274 of 4as4A
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
27% identity, 86% coverage: 10:244/272 of query aligns to 13:248/277 of P29218
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
27% identity, 86% coverage: 10:244/272 of query aligns to 9:244/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
27% identity, 86% coverage: 10:244/272 of query aligns to 9:244/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
27% identity, 86% coverage: 10:244/272 of query aligns to 9:244/272 of 1awbA
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
27% identity, 86% coverage: 10:244/272 of query aligns to 9:244/266 of 1imdA
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
26% identity, 86% coverage: 12:244/272 of query aligns to 13:246/274 of 4as5A
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
26% identity, 86% coverage: 12:244/272 of query aligns to 15:248/277 of O55023
1qgxA X-ray structure of yeast hal2p (see paper)
31% identity, 59% coverage: 81:241/272 of query aligns to 136:319/354 of 1qgxA
Sites not aligning to the query:
1ka1A The papase hal2p complexed with calcium and magnesium ions and reaction substrate: pap (see paper)
31% identity, 59% coverage: 81:241/272 of query aligns to 136:319/354 of 1ka1A
Sites not aligning to the query:
1k9zA The papase hal2p complexed with zinc ions
31% identity, 59% coverage: 81:241/272 of query aligns to 136:319/354 of 1k9zA
Sites not aligning to the query:
1k9yA The papase hal2p complexed with magnesium ions and reaction products: amp and inorganic phosphate (see paper)
31% identity, 59% coverage: 81:241/272 of query aligns to 136:319/354 of 1k9yA
Sites not aligning to the query:
P32179 3'(2'),5'-bisphosphate nucleotidase; 3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase; DPNPase; Halotolerance protein HAL2; Methionine-requiring protein 22; EC 3.1.3.7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
31% identity, 59% coverage: 81:241/272 of query aligns to 137:320/357 of P32179
Sites not aligning to the query:
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 89% coverage: 12:252/272 of query aligns to 93:325/346 of Q6NPM8
>GFF3890 FitnessBrowser__psRCH2:GFF3890
MNHPYLSSVIDLVRQAGAVILPHWRSELAVQAKADDSPVTAADMAAHRVLADGLRALDGA
IPVLSEEDCELSLAERASWTRWWLVDPLDGTKEFIAGSEEFTVNVALIEEGKVRFGVVGI
PASGRCYYGGEDFGAWRSEADGAAEPLRVRRQPVDAFTVVASRRHSSPAQEQLLGRLGER
FGELALANVGSSLKFCLLAEGAADCYPRLAPTSQWDTAAAQGVLEGAGGEVLDVSGVPLR
YEARASYLNPSFLALPKDVDWRDWLIELANRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory