SitesBLAST
Comparing GFF3899 FitnessBrowser__psRCH2:GFF3899 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
47% identity, 97% coverage: 8:405/412 of query aligns to 291:690/692 of 6iunB
- active site: S407 (= S124), H428 (= H145), E440 (= E157), N478 (= N195)
- binding nicotinamide-adenine-dinucleotide: G300 (= G17), T301 (= T18), M302 (= M19), E321 (≠ D38), T322 (≠ N39), Y365 (= Y82), A377 (= A94), V378 (= V95), E380 (= E97), V384 (≠ L101), V388 (≠ I105), N405 (= N122), S407 (= S124)
Sites not aligning to the query:
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
40% identity, 90% coverage: 8:379/412 of query aligns to 301:684/725 of 3zwbA
Sites not aligning to the query:
- active site: 66, 81, 105, 108, 127, 128, 135, 136
- binding (2E)-Hexenoyl-CoA: 25, 26, 28, 64, 65, 66, 67, 68, 101, 103, 105, 108, 136, 161, 280
3zw9A Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2- methylbutanoyl-coa (see paper)
40% identity, 90% coverage: 8:379/412 of query aligns to 299:682/723 of 3zw9A
- active site: S413 (= S124), H434 (= H145), E446 (= E157), N484 (= N195)
- binding nicotinamide-adenine-dinucleotide: L305 (≠ I14), G306 (= G15), G308 (= G17), T309 (= T18), M310 (= M19), E329 (≠ D38), Q334 (≠ M43), A383 (= A94), V384 (= V95), F385 (≠ Y96), E386 (= E97), N411 (= N122), S413 (= S124), H434 (= H145)
Sites not aligning to the query:
- active site: 64, 69, 79, 103, 106, 125, 126, 133, 134, 252
- binding (2s,3s)-3-hydroxy-2-methylbutanoyl-coa: 24, 62, 63, 64, 66, 102, 103, 106, 126, 133, 159
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
40% identity, 90% coverage: 8:379/412 of query aligns to 302:685/727 of 3zwaA
Sites not aligning to the query:
- active site: 67, 72, 82, 106, 109, 128, 129, 136, 137, 255
- binding (S)-3-Hydroxyhexanoyl-CoA: 27, 65, 66, 67, 68, 69, 104, 109, 124, 129, 132, 137, 162
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
40% identity, 90% coverage: 8:379/412 of query aligns to 301:684/725 of 5omoA
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding (s)-3-hydroxydecanoyl-coa: 25, 26, 28, 31, 64, 66, 67, 68, 103, 105, 108, 127, 128, 161, 260, 280
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
40% identity, 90% coverage: 8:379/412 of query aligns to 301:684/725 of 5mgbA
- active site: S415 (= S124), H436 (= H145), E448 (= E157), N486 (= N195)
- binding nicotinamide-adenine-dinucleotide: L307 (≠ I14), G308 (= G15), G310 (= G17), T311 (= T18), M312 (= M19), E331 (≠ D38), S332 (≠ N39), Q336 (≠ M43), V386 (= V95), F387 (≠ Y96), E388 (= E97), N413 (= N122), S415 (= S124), H436 (= H145)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding acetoacetyl-coenzyme a: 25, 26, 64, 65, 66, 67, 68, 105, 128, 161
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
40% identity, 90% coverage: 8:379/412 of query aligns to 301:684/725 of 3zwcA
- active site: S415 (= S124), H436 (= H145), E448 (= E157), N486 (= N195)
- binding nicotinamide-adenine-dinucleotide: G308 (= G15), G310 (= G17), T311 (= T18), M312 (= M19), E331 (≠ D38), Q336 (≠ M43), A385 (= A94), V386 (= V95), F387 (≠ Y96), E388 (= E97), K393 (= K102), N413 (= N122), S415 (= S124), H436 (= H145)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding (s)-3-hydroxydecanoyl-coa: 26, 64, 65, 66, 67, 68, 77, 78, 80, 101, 104, 105, 108, 128, 260
2x58A The crystal structure of mfe1 liganded with coa (see paper)
40% identity, 90% coverage: 8:379/412 of query aligns to 301:684/725 of 2x58A
- active site: S415 (= S124), H436 (= H145), E448 (= E157), N486 (= N195)
- binding adenosine-5'-diphosphate: G310 (= G17), T311 (= T18), M312 (= M19), E331 (≠ D38), S332 (≠ N39), Q336 (≠ M43), V386 (= V95), L392 (= L101)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding coenzyme a: 26, 28, 64, 66, 67, 68, 128
6zicAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with 3s-hydroxybutanoyl-coa and nadh'
40% identity, 90% coverage: 8:379/412 of query aligns to 301:682/723 of 6zicAAA
- active site: S413 (= S124), H434 (= H145), E446 (= E157), N484 (= N195)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G308 (= G15), G310 (= G17), T311 (= T18), M312 (= M19), E331 (≠ D38), S332 (≠ N39), Q336 (≠ M43), A383 (= A94), V384 (= V95), F385 (≠ Y96), E386 (= E97), L390 (= L101), K391 (= K102), N411 (= N122), S413 (= S124), H434 (= H145)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 136, 254
- binding 3-hydroxybutanoyl-coenzyme a: 25, 26, 28, 66, 67, 68, 104, 105, 108, 128, 161
6z5oAAA Peroxisomal bifunctional enzyme (see paper)
40% identity, 90% coverage: 8:379/412 of query aligns to 302:678/716 of 6z5oAAA
- active site: S409 (= S124), H430 (= H145), E442 (= E157), N480 (= N195)
- binding nicotinamide-adenine-dinucleotide: G309 (= G15), G311 (= G17), T312 (= T18), M313 (= M19), E332 (≠ D38), S333 (≠ N39), Q337 (≠ M43), A379 (= A94), V380 (= V95), F381 (≠ Y96), E382 (= E97), K387 (= K102), N407 (= N122), S409 (= S124), H430 (= H145)
Sites not aligning to the query:
- active site: 67, 72, 82, 106, 109, 128, 129, 137, 255
- binding coenzyme a: 26, 27, 65, 68, 69, 128, 162, 277, 281
- binding nicotinamide: 67, 109, 129, 136, 261
6zibAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nadh'
40% identity, 90% coverage: 8:379/412 of query aligns to 301:682/723 of 6zibAAA
- active site: S413 (= S124), H434 (= H145), E446 (= E157), N484 (= N195)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G310 (= G17), T311 (= T18), M312 (= M19), E331 (≠ D38), S332 (≠ N39), Q336 (≠ M43), A383 (= A94), V384 (= V95), F385 (≠ Y96), E386 (= E97), N411 (= N122), H434 (= H145)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 136, 254
- binding acetoacetyl-coenzyme a: 25, 26, 64, 65, 66, 67, 68, 104, 105, 128, 161
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
39% identity, 96% coverage: 8:402/412 of query aligns to 297:705/723 of Q08426
- A325 (≠ W36) to G: in dbSNP:rs1062555
- K346 (≠ T54) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- K584 (≠ E284) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- K598 (≠ A297) to T: in dbSNP:rs1042437
- T606 (≠ R305) to P: in dbSNP:rs1042438
Sites not aligning to the query:
- 3 E → K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
- 40 V → G: in dbSNP:rs1062551
- 41 I → R: in dbSNP:rs1062552
- 75 T → I: in dbSNP:rs1062553
- 165 modified: N6-acetyllysine; alternate; K→Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- 171 modified: N6-acetyllysine; K→Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
- 274 A → T: in dbSNP:rs2302819
3k6jA Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from c.Elegans
30% identity, 94% coverage: 6:393/412 of query aligns to 44:414/430 of 3k6jA
Sites not aligning to the query:
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
34% identity, 92% coverage: 25:405/412 of query aligns to 323:702/707 of 6yswA
Sites not aligning to the query:
- active site: 66, 71, 84, 88, 112, 115, 136, 137, 145, 264
- binding coenzyme a: 23, 25, 66, 67, 68, 136, 137, 140, 290, 293
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
32% identity, 94% coverage: 7:395/412 of query aligns to 360:750/763 of P40939
- E510 (= E157) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
Sites not aligning to the query:
- 282 V → D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- 305 I → N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- 342 L → P: in LCHAD deficiency; dbSNP:rs137852772
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
33% identity, 97% coverage: 7:405/412 of query aligns to 313:713/715 of 1wdlA
- active site: S430 (= S124), H451 (= H145), E463 (= E157), N501 (= N195)
- binding nicotinamide-adenine-dinucleotide: A322 (= A16), I324 (≠ T18), M325 (= M19), D344 (= D38), I345 (≠ N39), A400 (= A94), V401 (= V95), E403 (= E97), N428 (= N122), T429 (= T123), S430 (= S124)
Sites not aligning to the query:
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
33% identity, 97% coverage: 7:405/412 of query aligns to 313:713/715 of P28793
- M325 (= M19) binding
- D344 (= D38) binding
- VVE 401:403 (≠ VYE 95:97) binding
- K408 (= K102) binding
- S430 (= S124) binding
- N454 (≠ S148) binding
- N501 (= N195) binding
- Y660 (= Y351) binding
Sites not aligning to the query:
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
34% identity, 83% coverage: 31:370/412 of query aligns to 336:679/719 of 6tnmA
Sites not aligning to the query:
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 83% coverage: 31:370/412 of query aligns to 336:679/729 of P21177
- H450 (= H145) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
Sites not aligning to the query:
- 116 G→F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- 322 G→A: 10-fold increase in KM for NADH.
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
33% identity, 97% coverage: 7:405/412 of query aligns to 313:705/707 of 1wdmA
- active site: S430 (= S124), H451 (= H145), E463 (= E157), N501 (= N195)
- binding acetyl coenzyme *a: M459 (= M153), N501 (= N195), P534 (≠ A228), Y652 (= Y351), L658 (≠ A357)
- binding nicotinamide-adenine-dinucleotide: G321 (= G15), A322 (= A16), I324 (≠ T18), M325 (= M19), D344 (= D38), V401 (= V95), E403 (= E97), N428 (= N122), S430 (= S124), N454 (≠ S148)
Sites not aligning to the query:
Query Sequence
>GFF3899 FitnessBrowser__psRCH2:GFF3899
MSQTRFDIQTAAVIGAGTMGRGIVMSLANAGVQVRWLDNNPEMLERALGTVADTYAHNVR
QGRIDEAQAAARRACISKAADYQALADVDLVIEAVYENLELKQKIFRELDGIVKPAGILA
SNTSALDLDAIAAVTKRPEQVVGLHFFSPAHIMKLLEIVRGAKTSKAVLDASTELGKRMG
KVSVIAGNCQGFIGNRMLATYVREARMMLLEGAYPHQVDAALQGFGFAMGPFRMYDVVGI
DLEWRARELAGKGQDEVEVQVDNRLCELGRFGQKSRMGYYRYAEGSRQAEHDPEVDALVQ
RESERLGFQRREIGSEEILERCLLALVNEGAKILEEGMAESSADIDTVYLYGYGFPAEVG
GPMTWADRQGLPAIRDRLNALAERHGAHWQPAELIDSLATLGGRFADHKKEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory