SitesBLAST
Comparing GFF39 FitnessBrowser__Marino:GFF39 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2b1xA Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. (see paper)
31% identity, 100% coverage: 3:438/438 of query aligns to 27:438/441 of 2b1xA
- active site: H111 (= H87), D213 (= D189), H216 (= H192), H221 (= H197), D372 (= D373)
- binding fe (iii) ion: H216 (= H192), H221 (= H197), D372 (= D373)
- binding fe2/s2 (inorganic) cluster: C88 (= C64), H90 (= H66), R91 (= R67), C108 (= C84), Y110 (= Y86), H111 (= H87), W113 (= W89)
2b24A Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. Bound to indole (see paper)
31% identity, 100% coverage: 3:438/438 of query aligns to 27:438/440 of 2b24A
- active site: H111 (= H87), D213 (= D189), H216 (= H192), H221 (= H197), D372 (= D373)
- binding fe (iii) ion: H216 (= H192), H221 (= H197), D372 (= D373)
- binding fe2/s2 (inorganic) cluster: C88 (= C64), H90 (= H66), R91 (= R67), C108 (= C84), Y110 (= Y86), H111 (= H87), W113 (= W89)
- binding indole: D213 (= D189), H295 (≠ V297), F307 (= F308)
Q53122 Biphenyl 2,3-dioxygenase subunit alpha; Biphenyl dioxygenase system, oxygenase component subunit alpha; BDO, oxygenase component subunit alpha; Rieske dioxygenase; Terminal oxygenase component of biphenyl dioxygenase, large subunit; EC 1.14.12.18 from Rhodococcus jostii (strain RHA1) (see paper)
32% identity, 88% coverage: 2:386/438 of query aligns to 36:391/460 of Q53122
- C98 (= C64) binding
- H100 (= H66) binding
- C118 (= C84) binding
- H121 (= H87) binding
- 217:230 (vs. 185:198, 29% identical) binding
- H224 (= H192) binding
- H230 (≠ R198) binding
- D378 (= D373) binding
2gbxA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl (see paper)
29% identity, 100% coverage: 2:437/438 of query aligns to 13:418/449 of 2gbxA
- active site: H98 (= H87), D199 (= D189), H202 (= H192), H207 (= H197), D355 (= D373)
- binding biphenyl: D199 (= D189), V203 (≠ T193), L255 (= L251), H288 (≠ P295), N290 (≠ V297), L300 (≠ V318)
- binding fe (iii) ion: H202 (= H192), H207 (= H197), D355 (= D373)
- binding fe2/s2 (inorganic) cluster: C75 (= C64), H77 (= H66), R78 (= R67), C95 (= C84), Y97 (= Y86), H98 (= H87), W100 (= W89)
2gbwA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 (see paper)
29% identity, 100% coverage: 2:437/438 of query aligns to 13:418/449 of 2gbwA
- active site: H98 (= H87), D199 (= D189), H202 (= H192), H207 (= H197), D355 (= D373)
- binding fe (iii) ion: H202 (= H192), H207 (= H197), D355 (= D373)
- binding fe2/s2 (inorganic) cluster: C75 (= C64), H77 (= H66), R78 (= R67), C95 (= C84), Y97 (= Y86), H98 (= H87), W100 (= W89)
- binding oxygen molecule: H202 (= H192), F345 (= F363), D355 (= D373)
1uliC Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. Strain rha1 (see paper)
31% identity, 88% coverage: 2:386/438 of query aligns to 20:363/425 of 1uliC
- active site: H105 (= H87), D205 (= D189), H208 (= H192), H214 (≠ R198), D350 (= D373)
- binding fe (ii) ion: H208 (= H192), H214 (≠ R198), D350 (= D373)
- binding fe2/s2 (inorganic) cluster: C82 (= C64), H84 (= H66), R85 (= R67), C102 (= C84), Y104 (= Y86), H105 (= H87), W107 (= W89)
5aeuA Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 (see paper)
31% identity, 98% coverage: 2:429/438 of query aligns to 21:420/433 of 5aeuA
- active site: H106 (= H87), D204 (= D189), H207 (= H192), H213 (≠ R198), D362 (= D373)
- binding fe (ii) ion: H207 (= H192), H213 (≠ R198), D362 (= D373)
- binding fe2/s2 (inorganic) cluster: C83 (= C64), H85 (= H66), R86 (= R67), M88 (= M69), C103 (= C84), Y105 (= Y86), H106 (= H87), W108 (= W89)
1uljA Biphenyl dioxygenase (bpha1a2) in complex with the substrate (see paper)
31% identity, 88% coverage: 2:386/438 of query aligns to 20:365/425 of 1uljA
- active site: H105 (= H87), D205 (= D189), H208 (= H192), H214 (≠ R198), D352 (= D373)
- binding biphenyl: Q201 (= Q185), F202 (≠ S186), D205 (= D189), M206 (≠ G190), H208 (= H192), A209 (≠ T193), H214 (≠ R198), I252 (≠ G250), H287 (≠ V297), L297 (≠ V318), F342 (= F363)
- binding fe (ii) ion: Q201 (= Q185), H208 (= H192), H214 (≠ R198), D352 (= D373)
- binding fe2/s2 (inorganic) cluster: C82 (= C64), H84 (= H66), R85 (= R67), M87 (= M69), C102 (= C84), Y104 (= Y86), H105 (= H87), W107 (= W89)
3gzxA Crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. Strain b-356 (see paper)
31% identity, 90% coverage: 2:394/438 of query aligns to 21:390/440 of 3gzxA
- active site: H106 (= H87), D213 (= D189), H216 (= H192), H222 (≠ R198), D369 (= D373)
- binding biphenyl: Q209 (= Q185), F210 (≠ S186), H216 (= H192), G302 (≠ P295), H304 (≠ V297), L314 (≠ V318)
- binding fe (ii) ion: Q209 (= Q185), H216 (= H192), H222 (≠ R198), D369 (= D373)
- binding fe2/s2 (inorganic) cluster: C83 (= C64), H85 (= H66), R86 (= R67), C103 (= C84), Y105 (= Y86), H106 (= H87), W108 (= W89)
2xshA Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl (see paper)
29% identity, 98% coverage: 2:429/438 of query aligns to 21:420/433 of 2xshA
- active site: H106 (= H87), D204 (= D189), H207 (= H192), H213 (≠ R198), D362 (= D373)
- binding 2,6-dichlorobiphenyl: F201 (≠ S186), M205 (≠ G190), H207 (= H192), Q296 (≠ F308), H297 (≠ V309), L307 (≠ V319), F358 (≠ V369)
- binding fe (ii) ion: Q200 (= Q185), H207 (= H192), H213 (≠ R198), D362 (= D373)
- binding fe2/s2 (inorganic) cluster: C83 (= C64), H85 (= H66), R86 (= R67), C103 (= C84), Y105 (= Y86), H106 (= H87), W108 (= W89)
2yflA Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran (see paper)
29% identity, 98% coverage: 2:429/438 of query aligns to 21:420/433 of 2yflA
- active site: H106 (= H87), D204 (= D189), H207 (= H192), H213 (≠ R198), D362 (= D373)
- binding 2-chlorodibenzofuran: Q200 (= Q185), D204 (= D189), M205 (≠ G190), H207 (= H192), S257 (≠ G269), H297 (≠ V309), L307 (≠ V319), F352 (= F363)
- binding fe (ii) ion: Q200 (= Q185), H207 (= H192), H213 (≠ R198), D362 (= D373)
- binding fe2/s2 (inorganic) cluster: C83 (= C64), H85 (= H66), R86 (= R67), C103 (= C84), Y105 (= Y86), H106 (= H87), W108 (= W89)
2yfjA Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran (see paper)
29% identity, 98% coverage: 2:429/438 of query aligns to 21:420/433 of 2yfjA
- active site: H106 (= H87), D204 (= D189), H207 (= H192), H213 (≠ R198), D362 (= D373)
- binding dibenzofuran: Q200 (= Q185), F201 (≠ S186), D204 (= D189), M205 (≠ G190), H207 (= H192), A208 (≠ T193), H297 (≠ V309), L307 (≠ V319), F358 (≠ V369)
- binding fe (ii) ion: Q200 (= Q185), H207 (= H192), H213 (≠ R198), D362 (= D373)
- binding fe2/s2 (inorganic) cluster: C83 (= C64), H85 (= H66), R86 (= R67), C103 (= C84), Y105 (= Y86), H106 (= H87), W108 (= W89)
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
32% identity, 86% coverage: 2:377/438 of query aligns to 20:364/424 of 3en1A
- active site: H105 (= H87), D205 (= D189), H208 (= H192), H214 (≠ R198), D360 (= D373)
- binding fe (ii) ion: Q201 (= Q185), H208 (= H192), H214 (≠ R198), D360 (= D373)
- binding fe2/s2 (inorganic) cluster: C82 (= C64), H84 (= H66), R85 (= R67), C102 (= C84), Y104 (= Y86), H105 (= H87), W107 (= W89)
- binding toluene: Q201 (= Q185), F202 (≠ S186), D205 (= D189), H208 (= H192), H295 (≠ V289)
1wqlA Cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 (see paper)
32% identity, 89% coverage: 2:390/438 of query aligns to 21:382/436 of 1wqlA
- active site: H106 (= H87), D208 (= D189), H211 (= H192), H217 (≠ R198), D365 (= D373)
- binding fe (ii) ion: H211 (= H192), H217 (≠ R198), D365 (= D373)
- binding fe2/s2 (inorganic) cluster: C83 (= C64), H85 (= H66), R86 (= R67), C103 (= C84), Y105 (= Y86), H106 (= H87), W108 (= W89)
- binding oxygen molecule: H211 (= H192), F355 (= F363)
2xrxA Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400 (see paper)
29% identity, 98% coverage: 2:429/438 of query aligns to 21:419/432 of 2xrxA
- active site: H106 (= H87), D203 (= D189), H206 (= H192), H212 (≠ R198), D361 (= D373)
- binding biphenyl: Q199 (= Q185), F200 (≠ S186), D203 (= D189), H206 (= H192), H296 (≠ V309), L306 (≠ V319), F309 (≠ M322), F357 (≠ V369)
- binding fe (ii) ion: Q199 (= Q185), H206 (= H192), H212 (≠ R198), D361 (= D373)
- binding fe2/s2 (inorganic) cluster: C83 (= C64), H85 (= H66), R86 (= R67), C103 (= C84), Y105 (= Y86), H106 (= H87), W108 (= W89)
2ckfE Crystal structure of the terminal component of the pah- hydroxylating dioxygenase from sphingomonas sp chy-1 (see paper)
28% identity, 100% coverage: 2:437/438 of query aligns to 18:403/433 of 2ckfE
- active site: H103 (= H87), D204 (= D189), H207 (= H192), H212 (= H197), D340 (= D373)
- binding fe (iii) ion: H207 (= H192), H212 (= H197), D340 (= D373)
- binding fe2/s2 (inorganic) cluster: C80 (= C64), H82 (= H66), R83 (= R67), C100 (= C84), Y102 (= Y86), H103 (= H87), W105 (= W89)
5xbpA Oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2 (see paper)
30% identity, 87% coverage: 3:385/438 of query aligns to 17:371/444 of 5xbpA
- active site: H101 (= H87), D202 (= D189), H205 (= H192), H210 (= H197), D359 (= D373)
- binding fe (iii) ion: H205 (= H192), H210 (= H197), D359 (= D373)
- binding fe2/s2 (inorganic) cluster: C78 (= C64), H80 (= H66), R81 (= R67), C98 (= C84), Y100 (= Y86), H101 (= H87)
2bmrA The crystal structure of nitrobenzene dioxygenase in complex with 3- nitrotoluene (see paper)
29% identity, 89% coverage: 1:392/438 of query aligns to 14:377/437 of 2bmrA
- active site: H100 (= H87), D201 (= D189), H204 (= H192), H209 (= H197), D358 (= D373)
- binding 3-nitrotoluene: F198 (≠ S186), D201 (= D189), H204 (= H192), V205 (≠ T193), N256 (≠ R246), F291 (≠ M293), N293 (≠ P295)
- binding fe (iii) ion: H204 (= H192), H209 (= H197), D358 (= D373)
- binding fe2/s2 (inorganic) cluster: C77 (= C64), H79 (= H66), R80 (= R67), C97 (= C84), Y99 (= Y86), H100 (= H87), W102 (= W89)
2bmqA The crystal structure of nitrobenzene dioxygenase in complex with nitrobenzene (see paper)
29% identity, 89% coverage: 1:392/438 of query aligns to 14:377/437 of 2bmqA
- active site: H100 (= H87), D201 (= D189), H204 (= H192), H209 (= H197), D358 (= D373)
- binding fe (iii) ion: H204 (= H192), H209 (= H197), D358 (= D373)
- binding fe2/s2 (inorganic) cluster: C77 (= C64), H79 (= H66), R80 (= R67), C97 (= C84), Y99 (= Y86), H100 (= H87), W102 (= W89)
- binding nitrobenzene: N197 (≠ Q185), F198 (≠ S186), H204 (= H192), N256 (≠ R246), F291 (≠ M293), N293 (≠ P295)
2bmoA The crystal structure of nitrobenzene dioxygenase (see paper)
29% identity, 89% coverage: 1:392/438 of query aligns to 14:377/437 of 2bmoA
- active site: H100 (= H87), D201 (= D189), H204 (= H192), H209 (= H197), D358 (= D373)
- binding fe (iii) ion: H204 (= H192), H209 (= H197), D358 (= D373)
- binding fe2/s2 (inorganic) cluster: C77 (= C64), H79 (= H66), R80 (= R67), C97 (= C84), Y99 (= Y86), H100 (= H87), W102 (= W89)
Query Sequence
>GFF39 FitnessBrowser__Marino:GFF39
MRVLSDREIYQLEMEKVFGKTWLMLGHESEIPNPGDFMVRDMGEDSVIVTRDKSGEVHVL
LNVCPHRGMRVALTDCGNSQIHKCIYHGWAFRPNGDFIGAPVEKEKMHGSMLEKSELGLK
RARCTLYGGLIFATWNIEGPSFDEFLGDAKWYYDMLFLRSDKGMEVLGPPQRFIVNANWK
TAGEQSAADGFHTLTLHRWLGEIGNYSKKGEGEGDGADLSPEMYGVEVSSPHGHALRCID
LARKIRRITGLDPEKLSVEEKLEALPPAGMTVEMVDQLKRNLSEDQLKVLTSMPPQVGGM
FPNILFGFVYIPQPDGSVVGSMTMHTYIPRGPDKLEFCNWIFAEKDAPPELRQKMLEQTV
QLFGTSGMVEQDDSDTWPHMTLSAKGAMGKHITMKYQAVYETGAPEGWPGPGIVNEGFTK
DDTQWHWWLYWNELMNAD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory