Comparing GFF3908 FitnessBrowser__Phaeo:GFF3908 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
35% identity, 86% coverage: 26:246/258 of query aligns to 5:226/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
35% identity, 86% coverage: 26:246/258 of query aligns to 5:224/225 of 4zv2A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
34% identity, 85% coverage: 26:245/258 of query aligns to 11:228/229 of 5t0wA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
32% identity, 88% coverage: 24:251/258 of query aligns to 12:236/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
32% identity, 88% coverage: 24:251/258 of query aligns to 16:240/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
32% identity, 88% coverage: 24:251/258 of query aligns to 16:240/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
32% identity, 88% coverage: 24:251/258 of query aligns to 16:240/241 of 3vvdA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
33% identity, 88% coverage: 23:248/258 of query aligns to 1:224/226 of 8eyzA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
31% identity, 85% coverage: 27:245/258 of query aligns to 12:227/229 of 6svfA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
30% identity, 84% coverage: 29:245/258 of query aligns to 5:222/224 of 4ymxA
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
29% identity, 87% coverage: 26:250/258 of query aligns to 15:238/240 of 2ylnA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
28% identity, 85% coverage: 29:248/258 of query aligns to 5:223/231 of 2q2cA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
28% identity, 85% coverage: 29:248/258 of query aligns to 9:227/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
28% identity, 85% coverage: 29:248/258 of query aligns to 15:233/241 of 2q2aA
8gtuA Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with clidinium (see paper)
29% identity, 89% coverage: 27:256/258 of query aligns to 5:233/236 of 8gtuA
8gu1A Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with pimozide (see paper)
29% identity, 89% coverage: 27:256/258 of query aligns to 3:231/234 of 8gu1A
6aalA Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with arginine (see paper)
29% identity, 89% coverage: 27:256/258 of query aligns to 3:231/234 of 6aalA
6a80A Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with cystine (see paper)
29% identity, 89% coverage: 27:256/258 of query aligns to 3:231/234 of 6a80A
4gvoA Putative l-cystine abc transporter from listeria monocytogenes
31% identity, 87% coverage: 26:250/258 of query aligns to 3:232/236 of 4gvoA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
25% identity, 86% coverage: 27:249/258 of query aligns to 10:235/237 of 4i62A
>GFF3908 FitnessBrowser__Phaeo:GFF3908
MMKPFAWAAAVAASLTAAPSAFASDTLRVGMSGGYFPFTFVRQDVLQGFEVDVMNAVAEE
TGLEVEFVTMSFSGLIGALESDRIDTIANQITITPERSAKFAFTQAYVIDGAQVVVKRGN
EDSIAGPADLAGKTVAVNLGSNFEQLLRELPQADKIEIKTYEANIAQDTALGRVDAFVMD
RVSSAQLIQESPLPLALAGAPFSEIRNALPFRQGADSLALRDRVDTALTTLREGGKLAEI
SQKWFGTDITAVSAPAEK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory