Comparing GFF3910 FitnessBrowser__Phaeo:GFF3910 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
52% identity, 96% coverage: 10:250/251 of query aligns to 4:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
52% identity, 96% coverage: 10:250/251 of query aligns to 4:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
52% identity, 96% coverage: 10:250/251 of query aligns to 4:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
52% identity, 96% coverage: 10:250/251 of query aligns to 4:241/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
53% identity, 97% coverage: 8:250/251 of query aligns to 1:239/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
50% identity, 96% coverage: 10:250/251 of query aligns to 2:239/240 of 4ymuJ
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
45% identity, 95% coverage: 10:248/251 of query aligns to 3:250/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
45% identity, 95% coverage: 10:248/251 of query aligns to 7:254/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 95% coverage: 10:248/251 of query aligns to 2:242/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 95% coverage: 10:248/251 of query aligns to 3:243/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 95% coverage: 10:248/251 of query aligns to 3:243/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 95% coverage: 10:248/251 of query aligns to 3:243/344 of 6cvlD
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
40% identity, 93% coverage: 15:247/251 of query aligns to 33:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
40% identity, 93% coverage: 15:247/251 of query aligns to 33:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
41% identity, 89% coverage: 15:238/251 of query aligns to 33:254/260 of 7ahdC
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
40% identity, 89% coverage: 8:230/251 of query aligns to 3:226/648 of P75831
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 97% coverage: 4:247/251 of query aligns to 12:248/378 of P69874
Sites not aligning to the query:
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
39% identity, 84% coverage: 15:226/251 of query aligns to 9:217/223 of 2pclA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
35% identity, 84% coverage: 15:226/251 of query aligns to 10:218/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
35% identity, 84% coverage: 15:226/251 of query aligns to 10:218/230 of 6z4wA
>GFF3910 FitnessBrowser__Phaeo:GFF3910
MKDTTQGPAISITGLRKTFGDSVVLDGIDLTIQPGERIVIIGPSGTGKSTLLRCLNFLDA
PDAGLVRIGDLDVDAARASKAEILALRRRTAFVFQNYALFANKTAAENIMEALITVQKQP
RAEAEARAREILAETGLADKADAYPASLSGGQQQRVGIGRAMALGAELMLFDEPTSALDP
EWVGEVLALMHKVAEERQTMLIVTHEMQFAREIADRVVFMEGGRIVEQGPPTQIFDAPQD
PRTRAFLRRVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory