Comparing GFF3915 FitnessBrowser__Marino:GFF3915 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rl5G The first crystal structure of the daba aminotransferase ectb in the ectoine biosynthesis pathway of the model organism chromohalobacter salexigens dsm 3034 (see paper)
56% identity, 98% coverage: 2:414/422 of query aligns to 3:419/422 of 6rl5G
1sffA Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate (see paper)
31% identity, 97% coverage: 5:415/422 of query aligns to 9:425/425 of 1sffA
1sf2A Structure of e. Coli gamma-aminobutyrate aminotransferase (see paper)
31% identity, 97% coverage: 5:415/422 of query aligns to 9:425/425 of 1sf2A
P22256 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 97% coverage: 5:415/422 of query aligns to 10:426/426 of P22256
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
30% identity, 97% coverage: 5:415/422 of query aligns to 9:425/425 of 1szkA
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
34% identity, 93% coverage: 14:406/422 of query aligns to 8:372/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
34% identity, 93% coverage: 14:406/422 of query aligns to 7:371/375 of 2eh6A
A0A0J9X1Q5 Aminotransferase PigE; EC 2.6.1.- from Serratia sp. (strain FS14) (see paper)
33% identity, 83% coverage: 21:371/422 of query aligns to 418:756/853 of A0A0J9X1Q5
4ppmA Crystal structure of pige: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (map) from serratia sp. Fs14 (see paper)
29% identity, 93% coverage: 21:413/422 of query aligns to 47:457/464 of 4ppmA
Sites not aligning to the query:
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
32% identity, 93% coverage: 19:410/422 of query aligns to 18:389/390 of 8ht4B
P50457 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 from Escherichia coli (strain K12) (see paper)
33% identity, 94% coverage: 25:420/422 of query aligns to 29:421/421 of P50457
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
32% identity, 91% coverage: 20:401/422 of query aligns to 21:377/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
32% identity, 91% coverage: 20:401/422 of query aligns to 21:377/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
32% identity, 91% coverage: 20:401/422 of query aligns to 21:377/387 of 1vefA
Sites not aligning to the query:
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
32% identity, 91% coverage: 20:401/422 of query aligns to 29:385/395 of Q5SHH5
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
28% identity, 95% coverage: 11:410/422 of query aligns to 5:385/388 of 3nx3A
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
29% identity, 95% coverage: 11:413/422 of query aligns to 4:385/385 of Q9X2A5
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
29% identity, 95% coverage: 11:413/422 of query aligns to 12:393/393 of 2ordA
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 96% coverage: 5:410/422 of query aligns to 60:453/457 of Q9M8M7
Sites not aligning to the query:
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
30% identity, 96% coverage: 8:414/422 of query aligns to 10:399/400 of 4addA
>GFF3915 FitnessBrowser__Marino:GFF3915
MEIFKSTESEVRVYSRAFPVIFNRAKNAHLYTEDGKEYLDFLAGAGSLNYGHNNDTLKKA
LLEYIEADGVSQGLDMFTTAKHDFMESYKKHILDPRGLDYKMQFTGPTGTNCVEAALKLA
RKVKGRSGIISFTNGFHGVTMGAVATTGNKHHRGGVGTPLGNVDFMFYDGYLGDDVDTLA
IMDKLLSDGSSGFELPAAVIVEAVQGEGGLNACRAEWLKGLSELCKKHDILLILDDIQAG
NGRTGEFFSFEFAGIKPDIVTVSKSLSGYGLPMALVLFKPELDVWDPGEHNGTFRGNNMA
FITARAAVENYWKDDAFANEVKAKTEVLGDALQSICDKYPGQFKMKGRGLMRGIEAKHAD
ITGPITKRAFEHGLIIETSGPNDEVIKCLMPLTTSEEDLKKGAALLAKSVDEIMQEGLSE
AS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory