Comparing GFF3918 FitnessBrowser__Phaeo:GFF3918 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
38% identity, 47% coverage: 70:202/284 of query aligns to 63:188/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
38% identity, 47% coverage: 70:202/284 of query aligns to 63:188/211 of 4hurA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
38% identity, 47% coverage: 70:202/284 of query aligns to 63:188/206 of 6x3jA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
38% identity, 47% coverage: 70:202/284 of query aligns to 63:188/207 of 6x3cA
Sites not aligning to the query:
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
38% identity, 47% coverage: 70:202/284 of query aligns to 63:188/203 of 6x3cE
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
36% identity, 47% coverage: 70:202/284 of query aligns to 64:189/204 of 1mrlA
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
36% identity, 47% coverage: 70:202/284 of query aligns to 64:189/205 of 1kk4A
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
36% identity, 47% coverage: 70:202/284 of query aligns to 64:189/206 of 1khrA
Sites not aligning to the query:
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
36% identity, 47% coverage: 70:202/284 of query aligns to 64:189/209 of P50870
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
36% identity, 47% coverage: 70:202/284 of query aligns to 64:189/203 of 3dhoA
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
38% identity, 45% coverage: 70:198/284 of query aligns to 59:180/206 of 6u9cA
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
38% identity, 45% coverage: 70:198/284 of query aligns to 62:183/210 of 6pubA
Sites not aligning to the query:
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
36% identity, 48% coverage: 70:204/284 of query aligns to 58:186/208 of 2xatA
Sites not aligning to the query:
7uujA Crystal structure of aminoglycoside resistance enzyme apma, complex with gentamicin
39% identity, 31% coverage: 115:202/284 of query aligns to 165:254/272 of 7uujA
Sites not aligning to the query:
7jm2A Crystal structure of aminoglycoside resistance enzyme apma, complex with apramycin
39% identity, 31% coverage: 115:202/284 of query aligns to 165:254/272 of 7jm2A
Sites not aligning to the query:
7jm1A Crystal structure of aminoglycoside resistance enzyme apma, complex with acetyl-coa
39% identity, 31% coverage: 115:202/284 of query aligns to 165:254/272 of 7jm1A
Sites not aligning to the query:
7uukC Crystal structure of aminoglycoside resistance enzyme apma, complex with tobramycin (see paper)
39% identity, 31% coverage: 115:202/284 of query aligns to 167:256/276 of 7uukC
Sites not aligning to the query:
7uulA Crystal structure of aminoglycoside resistance enzyme apma, complex with kanamycin b and coenzyme a (see paper)
39% identity, 31% coverage: 115:202/284 of query aligns to 166:255/274 of 7uulA
Sites not aligning to the query:
7uumA Crystal structure of aminoglycoside resistance enzyme apma, complex with paromomycin and coenzyme a (see paper)
39% identity, 31% coverage: 115:202/284 of query aligns to 167:256/274 of 7uumA
Sites not aligning to the query:
7uunA Crystal structure of aminoglycoside resistance enzyme apma, complex with neomycin (see paper)
39% identity, 31% coverage: 115:202/284 of query aligns to 166:255/273 of 7uunA
Sites not aligning to the query:
>GFF3918 FitnessBrowser__Phaeo:GFF3918
MRRLLADHHVMPKPWRNERDLTALKRISFPLDLSLSVLTRHGLKAGGLLPLSSIGYMSYS
HSPSRNWSAGAFCSIAAGLRVLGDRHPIRRVSSHPFSYGPYYGKLARDLGAETYEPHARF
NTKTPPVRIGNDVWIGRGVQMAGGITIGNGAVVAAGAIVTKDVPPYAVVGGVPARVLKYR
FAAPLIARLEATAWWDYPLETLAAFKMGHPRRFCKAFEPEEANLAKREERWITAADLQAL
AAPVDVARASLSRAITLPEGRTRGPVSKQIRRISDRLTRIVRSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory