Comparing GFF3918 FitnessBrowser__Phaeo:GFF3918 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8j40A Crystal structure of catb8 in complex with chloramphenicol (see paper)
40% identity, 47% coverage: 70:202/284 of query aligns to 59:185/209 of 8j40A
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
38% identity, 47% coverage: 70:202/284 of query aligns to 63:188/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
38% identity, 47% coverage: 70:202/284 of query aligns to 63:188/211 of 4hurA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
38% identity, 47% coverage: 70:202/284 of query aligns to 63:188/206 of 6x3jA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
38% identity, 47% coverage: 70:202/284 of query aligns to 63:188/207 of 6x3cA
Sites not aligning to the query:
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
38% identity, 47% coverage: 70:202/284 of query aligns to 63:188/203 of 6x3cE
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
36% identity, 47% coverage: 70:202/284 of query aligns to 64:189/204 of 1mrlA
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
36% identity, 47% coverage: 70:202/284 of query aligns to 64:189/205 of 1kk4A
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
36% identity, 47% coverage: 70:202/284 of query aligns to 64:189/206 of 1khrA
Sites not aligning to the query:
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
36% identity, 47% coverage: 70:202/284 of query aligns to 64:189/209 of P50870
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
36% identity, 47% coverage: 70:202/284 of query aligns to 64:189/203 of 3dhoA
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
38% identity, 45% coverage: 70:198/284 of query aligns to 59:180/206 of 6u9cA
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
38% identity, 45% coverage: 70:198/284 of query aligns to 62:183/210 of 6pubA
Sites not aligning to the query:
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
36% identity, 48% coverage: 70:204/284 of query aligns to 58:186/208 of 2xatA
Sites not aligning to the query:
7uujA Crystal structure of aminoglycoside resistance enzyme apma, complex with gentamicin
39% identity, 31% coverage: 115:202/284 of query aligns to 165:254/272 of 7uujA
Sites not aligning to the query:
7jm2A Crystal structure of aminoglycoside resistance enzyme apma, complex with apramycin
39% identity, 31% coverage: 115:202/284 of query aligns to 165:254/272 of 7jm2A
Sites not aligning to the query:
7jm1A Crystal structure of aminoglycoside resistance enzyme apma, complex with acetyl-coa
39% identity, 31% coverage: 115:202/284 of query aligns to 165:254/272 of 7jm1A
Sites not aligning to the query:
7uukC Crystal structure of aminoglycoside resistance enzyme apma, complex with tobramycin (see paper)
39% identity, 31% coverage: 115:202/284 of query aligns to 167:256/276 of 7uukC
Sites not aligning to the query:
7uulA Crystal structure of aminoglycoside resistance enzyme apma, complex with kanamycin b and coenzyme a (see paper)
39% identity, 31% coverage: 115:202/284 of query aligns to 166:255/274 of 7uulA
Sites not aligning to the query:
7uumA Crystal structure of aminoglycoside resistance enzyme apma, complex with paromomycin and coenzyme a (see paper)
39% identity, 31% coverage: 115:202/284 of query aligns to 167:256/274 of 7uumA
Sites not aligning to the query:
>GFF3918 FitnessBrowser__Phaeo:GFF3918
MRRLLADHHVMPKPWRNERDLTALKRISFPLDLSLSVLTRHGLKAGGLLPLSSIGYMSYS
HSPSRNWSAGAFCSIAAGLRVLGDRHPIRRVSSHPFSYGPYYGKLARDLGAETYEPHARF
NTKTPPVRIGNDVWIGRGVQMAGGITIGNGAVVAAGAIVTKDVPPYAVVGGVPARVLKYR
FAAPLIARLEATAWWDYPLETLAAFKMGHPRRFCKAFEPEEANLAKREERWITAADLQAL
AAPVDVARASLSRAITLPEGRTRGPVSKQIRRISDRLTRIVRSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory